Identifiers and Description

Gene Model Identifier

TTHERM_00684620

Standard Name

None

Aliases

PreTt18175 | 104.m00107 | 3732.m00021

Description

kelch motif protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00684620

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17351.19.997093137033517e-262kelch domain-containing protei
n family protein (771 aa)
OxytrichaContig2203.0.g75.000040196085687e-64Kelch motif
Stentor CoeruleusSteCoe_274891.185064864233981e-27
DictyBaseDDB_G02807654.997543945741262e-17DDB_G0280765 on chromosome: 3
position 3715566 to 3718006
WormBaseWBGene000018270.00000000000008999700526206354locus:hcf-1 status:Confirmed
UniProt:G5EC23 protein_id
:CCD66593.1
SGDYGR238C0.00000000019994075865167896KEL2 Protein that functions in
a complex with Kel1p to negat
ively regulate mitotic exit, i
nteracts with Tem1p and Lte1p;
localizes to regions of polar
ized growth; potential Cdc28p
substrate

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00684620(coding)
ATGATGTTTTCAACGTCTAGACTTCATTTAGATTAACCCATGGAAAAAATAACCTACAAT
CCTAACTAAACAGTTTCCTCATCTCAAAAAAAATTTTACATAAAATAAGATACAGATTCT
CCAATTAAAAATAAAAGTTAATTCTAACATTCTACAAAGAGTTTTAGCAAAAAATAATTT
GAGTTATAAGTAAGGCAAACGTTTAGGTAAAGATTAGATAAAAAAAAAGATTTTATGACT
TAATCTGCCTTATAAAGCACTATAAATTCATCTGATGTAAGGACAGTTGAATAAATTTTT
AATTCAACTCATATGGCATTTTTAGCAGCACCAGATGATCTTTTGAATAAGTCTTTAGGT
AAAGACTACTTATCTATGAAGAGTTTTACTCCTATGTCAACAATTCTAGTTAATAACTAA
TCTTGGTAGTCATTTGCTAAAAGGAATTAAGATTAGAGCAATACAAGAGAAGTGATGTCA
AATCAACTTGTTTTCAATAGAACTTAAAAAAATTTCCTAGTAAATTAAGCTTAAAAAAAC
TATACAGAAAATTATGATTAATTGATTGACTCATATAGAAAAAGGGAATAAAAATTTAAT
TTACCTAAGATTAAGGTTAAGAATCATGACTAAGTGTTAAATAATATGGCTAAGTAGTAA
AGCACATCTCCAGTTATTGGAACTGAAGGTAATCTGATGCCATAATAGCATAACGAAGAA
GACGATGATCCGTTTAACAATTAAAATAAAGAATAAAATGAGAAAAAGCTAACAAATTTA
AAATTTTATTGGTATTGTATCACTGATGATGGTTGGAGACCTGAGACAAGAGAATATCCG
AGTCTTACATACATTGATGGAAGATTATATTTATACGGAGGCATGGGTTTAGATTTATTT
AACACAATGTGCTACCTTGATTTTCAAACATGGAAATGGACAAATATGGATTAAGCAGCT
TAACTTTAAGAAGGAAGATATGGTCATACTGCTCATTTATATAAAAAAGACTTGCTTGTA
TTTGGTGGAGAAAAAAAATATAATTCTCATCTTAAAATGAGATAATGTTTTAATGATATT
TAAATATACGAATTTTCTAAGAATAGTTGGAATTAAATTAGGACATTCGGAGATATTATT
GAAAATAGAAGAAATCATGCATCAGTTTTAATTACCAAGTTTTTATTTATATTTGGAGGT
ATCAACAGTTATAATAAACATTTATACGATTTTGTATCAATTAATTTAGAAACTTTTAAA
TGTAACATATTGTAAGTTGAAGGATTAGATAAAGGTCTCGCTTTCCACTAAATGACCCCT
ATTTTCAGAGGAGATGCTAAAATTGAAAATCCTTATTATAATGTAGAAATTAAAAAAACA
AAAGATAAAAAAGTTAGAAAAGTCAAAGAAGAAGGGTTGTACGTATTTGGAGGTTTGCTA
CAAAATGGAGAGGCAACAAATTAATTAAGAATAATAAAGCTAGGATAAAAACCACTTAAG
TGGGTAGTACCTGATGTTAAAGGAGCACTTCCAATGGCAAGATATCAACATTCTCAGCAC
TATTATGATGATTTAAATGTACTTATTGTTTATGGTGGCAGAAATGATAATTCAAAATTC
TATAGAAGCTATAATATGAATATTAGCTAAAATGGAATTCTTGGTGATATATGCCTCCTA
GACTTAGAAACATTAAATTGGATAAGTGTTGAAGAAAATGGTCTTAAGAATCTTCAAAAA
TGTGCTTTTGCATCCTAAATAATTGGATCTAAAATTATAATTTTTGGTGGATACCAAGAA
AAGGGGTTTGTAAATGCTGACATGTATGTCTTGGAATTAGATTAATCAAAAAACAGAAAA
TTAATTAAAGAGAGCAACAACCCTCTACAGTCAGGACTTTCTAAGAACTGCATTTCCATT
GTTGATATTTTGAATAACCATACTGACTTGTTTGATATTTAAGATGAGTTTTCTAAGCAA
AAAAAAAAGAAAAATTAGTTAAATGATACAGGTAGTAAAGTTGAATTGTCTGATAATGAA
ACAAGTCACATATTGGGTATGAGAACTTACTAGCCGATACCTTAAAGTATACTTAGGAGT
AGAAAATCATCTATAAATAAATCATTTTTGTCTTCTTTGCAATAAAATTAAAATGGACTT
AAATTCAAAGTTGATGATAATGGAATACCTTCATTAAATTGTGTACCTGAAGAAGAGGAG
GATTTGGGCTAGTTTAGTACAAAAATAATTATTGAATAAGAAAAATAATAAAATGTAAGT
AAAAATAAAAAAACAGTTAGCTATGCCTAAATCTGA


>TTHERM_00684620(protein)
MMFSTSRLHLDQPMEKITYNPNQTVSSSQKKFYIKQDTDSPIKNKSQFQHSTKSFSKKQF
ELQVRQTFRQRLDKKKDFMTQSALQSTINSSDVRTVEQIFNSTHMAFLAAPDDLLNKSLG
KDYLSMKSFTPMSTILVNNQSWQSFAKRNQDQSNTREVMSNQLVFNRTQKNFLVNQAQKN
YTENYDQLIDSYRKREQKFNLPKIKVKNHDQVLNNMAKQQSTSPVIGTEGNLMPQQHNEE
DDDPFNNQNKEQNEKKLTNLKFYWYCITDDGWRPETREYPSLTYIDGRLYLYGGMGLDLF
NTMCYLDFQTWKWTNMDQAAQLQEGRYGHTAHLYKKDLLVFGGEKKYNSHLKMRQCFNDI
QIYEFSKNSWNQIRTFGDIIENRRNHASVLITKFLFIFGGINSYNKHLYDFVSINLETFK
CNILQVEGLDKGLAFHQMTPIFRGDAKIENPYYNVEIKKTKDKKVRKVKEEGLYVFGGLL
QNGEATNQLRIIKLGQKPLKWVVPDVKGALPMARYQHSQHYYDDLNVLIVYGGRNDNSKF
YRSYNMNISQNGILGDICLLDLETLNWISVEENGLKNLQKCAFASQIIGSKIIIFGGYQE
KGFVNADMYVLELDQSKNRKLIKESNNPLQSGLSKNCISIVDILNNHTDLFDIQDEFSKQ
KKKKNQLNDTGSKVELSDNETSHILGMRTYQPIPQSILRSRKSSINKSFLSSLQQNQNGL
KFKVDDNGIPSLNCVPEEEEDLGQFSTKIIIEQEKQQNVSKNKKTVSYAQI


>TTHERM_00684620(gene)
ATGATGTTTTCAACGTCTAGACTTCATTTAGATTAACCCATGGAAAAAATAACCTACAAT
CCTAACTAAACAGTTTCCTCATCTCAAAAAAAATTTTACATAAAATAAGATACAGATTCT
CCAATTAAAAATAAAAGTTAATTCTAACATTCTACAAAGAGTTTTAGCAAAAAATAATTT
GAGTTATAAGTAAGGCAAACGTTTAGGTAAAGATTAGATAAAAAAAAAGATTTTATGACT
TAATCTGCCTTATAAAGCACTATAAATTCATCTGATGTAAGGACAGTTGAATAAATTTTT
AATTCAACTCATATGGCATTTTTAGCAGCACCAGATGATCTTTTGAATAAGTCTTTAGGT
AAAGACTACTTATCTATGAAGAGTTTTACTCCTATGTCAACAATTCTAGTTAATAACTAA
TCTTGGTAGTCATTTGCTAAAAGGAATTAAGATTAGAGCAATACAAGAGAAGTGATGTCA
AATCAACTTGTTTTCAATAGAACTTAAAAAAATTTCCTAGTAAATTAAGCTTAAAAAAAC
TATACAGAAAATTATGATTAATTGATTGACTCATATAGAAAAAGGGAATAAAAATTTAAT
TTACCTAAGATTAAGGTTAAGAATCATGACTAAGTGTTAAATAATATGGCTAAGTAGTAA
AGCACATCTCCAGTTATTGGAACTGAAGGTAATCTGATGCCATAATAGCATAACGAAGAA
GACGATGATCCGTTTAACAATTAAAATAAAGAATAAAATGAGAAAAAGCTAACAAATTTA
AAATTTTATTGGTATTGTATCACTGATGATGGTTGGAGACCTGAGACAAGAGAATATCCG
AGTCTTACATACATTGATGGAGTATGAAATATTATATATATTAAATTTTTAGCATCTTTA
TTTATTAAATAAGAGATTATATTTATACGGAGGCATGGGTTTAGATTTATTTAACACAAT
GTGCTACCTTGATTTTCAAACATGGAAATGGACAAATATGGATTAAGCAGCTTAACTTTA
AGAAGGAAGATATGGTCATACTGCTCATTTGTAAAATGAAATTTAAATATTTTATATTTT
AATTATTTTTTATGATATGAAAGATATAAAAAAGACTTGCTTGTATTTGGTGGAGAAAAA
AAATATAATTCTCATCTTAAAATGAGATAATGTTTTAATGATATTTAAATATACGAATTT
TCTAAGAATAGTTGGAATTAAATTAGGACATTCGGAGATATTATTGAAAATAGAAGAAAT
CATGCATCAGTTTTAATTACCAAGTTTTTATTTATATTTGGAGGTATCAACAGTTATAAT
AAACATTTATACGATTTTGTATCAATTAATTTAGAAACTTTTAAATGGTATTTTATTTAT
TTATTTATTTTTATCAAAATATTTGTACAAAAATGATAACTTTTTATTTTATGGATATTC
TAAAGTAACATATTGTAAGTTGAAGGATTAGATAAAGGTCTCGCTTTCCACTAAATGACC
CCTATTTTCAGAGGAGATGCTAAAATTGAAAATCCTTATTATAATGTAGAAATTAAAAAA
ACAAAAGATAAAAAAGTTAGAAAAGTCAAAGAAGAAGGGTTGTACGTATTTGGAGGTTTG
CTACAAAATGGAGAGGCAACAAATTAATTAAGAATAATAAAGCTAGGATAAAAACCACTT
AAGTGGGTAGTACCTGATGTTAAAGGAGCACTTCCAATGGCAAGATATCAACATTCTCAG
CACTATTATGATGATTTAAATGTACTTATTGTTTATGGTGGCAGAAATGATAATTCAAAA
TTCTATAGAAGCTATAATATGAATATTAGCTAAAATGGAATTCTTGGTGATATATGCCTC
CTAGACTTAGAAACATTAAATTGGATAAGTGTTGAAGAAAATGGTCTTAAGAATCTTCAA
AAATGTGCTTTTGCATCCTAAATAATTGGATCTAAAATTATAATTTTTGGTGGATACCAA
GAAAAGGGGTTTGTAAATGCTGACATGTATGTCTTGGAATTAGATTAATCAAAAAACAGA
AAATTAATTAAAGAGAGCAACAACCCTCTACAGTCAGGACTTTCTAAGAACTGCATTTCC
ATTGTTGATATTTTGAATAGTAAAAATTAAATTAACACAAACGAATTAATTTACATCAAA
TTAACATATTTTTAAAATGAATTAAACTTAAAAGACCATACTGACTTGTTTGATATTTAA
GATGAGTTTTCTAAGCAAAAAAAAAAGAAAAATTAGTTAAATGATACAGGTAGTAAAGTT
GAATTGTCTGATAATGAAACAAGTCACATATTGGGTATGAGAACTTACTAGCCGATACCT
TAAAGTATACTTAGGAGTAGAAAATCATCTATAAATAAATCATTTTTGTCTTCTTTGCAA
TAAAATTAAAATGGACTTAAATTCAAAGTAGTTATTTAACAGTAATTTTAATATAATGAA
TTATTTATAAAATATAAGGTTGATGATAATGGAATACCTTCATTAAATTGTGTACCTGAA
GAAGAGGAGGATTTGGGCTAGTTTAGTACAAAAATAATTATTGAATAAGAAAAATAATAA
AATGTAAGTAAAAATAAAAAAACAGTTAGCTATGCCTAAATCTGA