Identifiers and Description

Gene Model Identifier

TTHERM_00684540

Standard Name

None

Aliases

PreTt18167 | 104.m00099 | 3732.m00013

Description

NOL1/NOP2/sun family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08238 ) Sel1 repeat
  • ( PF01920 ) Prefoldin subunit
  • ( PF01189 ) NOL1/NOP2/sun family
  • ( TIGR00446 ) NOL1/NOP2/sun family putative RNA methylase
  • ( TIGR00563 ) ribosomal RNA small subunit methyltransferase
  • ( PF01993 ) methylene-5,6,7,8-tetrahydromethanopterin dehydrogenase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00684540

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17342.19.997093137033517e-262NOL1/NOP2/sun family protein (
782 aa)
OxytrichaContig13211.0.g848.002669202560376e-109NOL1/NOP2/sun family
SGDYBL024W1.9998099689916736e-77NCL1 S-adenosyl-L-methionine-d
ependent tRNA: m5C-methyltrans
ferase, methylates cytosine to
m5C at several positions in t
RNAs and intron-containing pre
-tRNAs; similar to Nop2p and h
uman proliferation associated
nucleolar protein p120
DictyBaseDDB_G02957158.998448382613942e-77DDB_G0295715 on chromosome: 3
position 5300180 to 5302549
WormBaseWBGene000216864.0006908853687255e-76status:Partially_confirmed U
niProt:Q9BL15 protein_id:CCD
73460.2
Stentor CoeruleusSteCoe_201832.7487850079102147e-43

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00684540(coding)
ATGGGAAGAAAAGGTGGTCATAAGAGAAGATTCAAAAATAAAAATAACTAAGGTTAAGAC
GGTTACAAAAAGTTTAAGGGGGATGATGGTTACAATGAATGGTATTACGATCATCCAATC
TTTGAAGCATATTACAAACTTTAACTTGAAGAAGCCTATTTTAAAGAAAAACCAGAAGAA
TTCACTCTTTTCTGGAATATGATGAAAGAAAAACTCCCAGTCGTTTTCAGAATCAATAAG
CTCACTCCTAATTACTAAGTCTTCCTCGATAACTTAAAAGATAAGGATTTTATCAAGAAA
TTTATTGAAGAAAAGAGAAAATAATTAGAGCAATAAGGAAAGGCTCCAACTGAAGGTTAA
TAATAAAAGGAATAGGAAGGTGAAGCTATTGAAGAAGAAGAACAAGAAGCTGAAAAGGAA
GCTGAAGAATAATAAAATGAAGATGAAGGTAATGGAGAAGGTGAAGAAGAAGAAGATGAT
GAAGACGAAGCAGACTAAAAGGAAGGAGATGATAAGAAGGGAGAAAACAACACTAAGACC
TTTGAAAAGTTTGAATTTAGCCAAGAAGAAATCGATACTCTTTAAATTAACAATATTAAG
TTCTATCCTGATGAATTAGTTTGGTAGATTAATTGCAACAGAACCTAATTGAAAAAATCA
TAATTACTCAAGGAGTTCCATAAGTATATTTAAAGAGCTAACGATTCAGGTTTAATTTCT
AGATAAGAATTAGTTTCAATGCTTCCTCCACTTTTACTTGATGTGAAGCCTGACGATATT
ATTTTTGATATGTGTGCTGCTCCAGGATCTAAAACTGCTTAGCTTCTTGAATTAATGTAC
ACTTAGGGAGGTATTAACACTAAGGGTGCTGTTGTTGCTAACGATGTAGACTAAAAAAGA
GCCTACTTACTTACTCATCAAGTTTGTAGAATCAATCCTAGTGGTTTAGTTGTTATTAAC
CATCCTGCTCAATTCTTCCCTACTCTTTAGGACCCCACATCAAATTAAGCTTATGATTAG
AAATTCTATTTTGACAAAGTTCAAGCTGATGTCCCTTGCTCTGGAGATGGTGCCACAAGA
AAAATTCCCACATAATGGAGAAACTGGAATACCAGAGATGGTCAAGTACTCCATCCTCTT
CAATTAGCTATTTTGTAAAGAGCTTTAACTCTCTGTAAAGTTGGTGGATATGTTCTTTAC
TCTACTTGTTCTATCAACCCTATTGAAGATGAAGCTGTTATAACTGAAGCTTTCCGTAGA
GCTAGTTAAGGATCTATTGAATTAATTGATATTCACACTAAATTCCCAGAACTTAAAGGA
AGAAGAGGTTTATCAAAGTGGACTGTCTGCTCTTCAACTAAAAAGCACCCTGGACATGAT
TAAGAAAAGAAGGAAACTGTAGCTGATTGGTTAAAAATTTATGACAACTTTGAATCTATC
GAAAAAAATGATAAGCTTGCATAATTCGTTAGAGACTCTATGTTCCCTGAACCTGAAGAT
AAAATGACTAATGAAATTAAAATTTAAAACACCATGCGTATTCTTCCTCATGATTAAGAC
ACTGGTGGTTTTTACTTAGCCTTAATCAAGAAGAACTCTTTGATCAATTGGAGCAAGAAG
GGATTACCTAAGACTGCTGGCTCTAATAATGAAGAATAATCTGCTTAATAGCAACAAGAG
CAACCCGCTTAATAATAAGTTGTTGATGATTATATTCCTGATGCTAGTGAAATACCCAAA
GAAGCTGAAAGCCTTTAAAACGTAGAAGGAGATGCCCAAGATGGTAAGAAAAATAACAAA
AATAAAGAACCAGTTCAAAAAGAAAATTTTGTAACCATTCCCGAAGAAGATTGGTAAAAT
ATAAAAGAAAACTACGGTATTGAAGGTATTGATTAGTCTTTATTCGTAGTTAACACTATT
GGAAAGTAAAAGGTTGTTAGATTAATTACTGAAGGTGCCAAAAAATTCAATGACTGTGAT
GTTAAAGGTGTTGTTAACAAAGTTAACATGGGTACAAAGGCTTTTGAGAGATCAAGAGAA
ACTTTCTAGGGAATTTAATGCAGATTTAGAATTTGCTAAGATTCTGTAAATTTAATTGCT
CCTTACATGAGCAAGAGAAAAATAGTTGTTTCTGAAGATGACTTTAAGTTCTTCGTTTAA
AATAAAAACGCTAAGTATACTGAAATGCCTAATTAAAAATTAAAAGAAGAAATTGCTTAA
TTAGGCCAAGGATCTATTATCCTTCACTGCCCTACCTACAATGATAATCTTGTCTGTTAG
AACTTCCATCAATCTGTAAATATCATGATTAGTAAGGAAATAACAGAATCATTCAAAATT
AGATATCTCAAATAATTATTCTGA


>TTHERM_00684540(protein)
MGRKGGHKRRFKNKNNQGQDGYKKFKGDDGYNEWYYDHPIFEAYYKLQLEEAYFKEKPEE
FTLFWNMMKEKLPVVFRINKLTPNYQVFLDNLKDKDFIKKFIEEKRKQLEQQGKAPTEGQ
QQKEQEGEAIEEEEQEAEKEAEEQQNEDEGNGEGEEEEDDEDEADQKEGDDKKGENNTKT
FEKFEFSQEEIDTLQINNIKFYPDELVWQINCNRTQLKKSQLLKEFHKYIQRANDSGLIS
RQELVSMLPPLLLDVKPDDIIFDMCAAPGSKTAQLLELMYTQGGINTKGAVVANDVDQKR
AYLLTHQVCRINPSGLVVINHPAQFFPTLQDPTSNQAYDQKFYFDKVQADVPCSGDGATR
KIPTQWRNWNTRDGQVLHPLQLAILQRALTLCKVGGYVLYSTCSINPIEDEAVITEAFRR
ASQGSIELIDIHTKFPELKGRRGLSKWTVCSSTKKHPGHDQEKKETVADWLKIYDNFESI
EKNDKLAQFVRDSMFPEPEDKMTNEIKIQNTMRILPHDQDTGGFYLALIKKNSLINWSKK
GLPKTAGSNNEEQSAQQQQEQPAQQQVVDDYIPDASEIPKEAESLQNVEGDAQDGKKNNK
NKEPVQKENFVTIPEEDWQNIKENYGIEGIDQSLFVVNTIGKQKVVRLITEGAKKFNDCD
VKGVVNKVNMGTKAFERSRETFQGIQCRFRICQDSVNLIAPYMSKRKIVVSEDDFKFFVQ
NKNAKYTEMPNQKLKEEIAQLGQGSIILHCPTYNDNLVCQNFHQSVNIMISKEITESFKI
RYLKQLF


>TTHERM_00684540(gene)
TATTAAACATTAGCATTATTATTAACTTATATACTCAAATTTATAACAACTATAATGGGA
AGAAAAGGTGGTCATAAGAGAAGATTCAAAAATAAAAATAACTAAGGTTAAGACGGTTAC
AAAAAGTTTAAGGGGGATGATGGTTACAATGAATGGTATTACGATCATCCAATCTTTGAA
GCATATTACAAAGTAACATTATGATTTTATTTTTTAGAGAACATTTCTATTGAAAACTTA
GATAAAGCTAATTAGTTTATAAATGCCAATCTAATGTGTTAAAATATTTATTCTTTAATT
AGCTTTAACTTGAAGAAGCCTATTTTAAAGAAAAACCAGAAGAATTCACTCTTTTCTGGA
ATATGATGAAAGAAAAACTCCCAGTCGTTTTCAGAATCAATAAGCTCACTCCTAATTACT
AAGTCTTCCTCGATAACTTAAAAGATAAGGATTTTATCAAGAAATTTATTGAAGAAAAGA
GAAAATAATTAGAGCAATAAGGAAAGGCTCCAACTGAAGGTTAATAATAAAAGGAATAGG
AAGGTGAAGCTATTGAAGAAGAAGAACAAGAAGCTGAAAAGGAAGCTGAAGAATAATAAA
ATGAAGATGAAGGTAATGGAGAAGGTGAAGAAGAAGAAGATGATGAAGACGAAGCAGACT
AAAAGGAAGGAGATGATAAGAAGGGAGAAAACAACACTAAGACCTTTGAAAAGTTTGAAT
TTAGCCAAGAAGAAATCGATACTCTTTAAATTAACAATATTAAGTTCTATCCTGATGAAT
TAGTTTGGTAGATTAATTGCAACAGAACCTAATTGAAAAAATCATAATTACTCAAGGAGT
TCCATAAGTATATTTAAAGAGCTAACGATTCAGGTTTAATTTCTAGATAAGAATTAGTTT
CAATGCTTCCTCCACTTTTACTTGATGTGAAGCCTGACGATATTATTTTTGATATGTGTG
CTGCTCCAGGTAATAATAACTTTAAAAGCTTAATTTAAATAAAATAGATTGATAGATATT
TCGGGAGATAACATTATTCACAAATAAAATTTTTATTTATTTATAATCGCAATAGATAAA
AACATTTATTTAATTTAAAAATAAATTTTATATGAATAAATGAATAAAGAAATTATTTTT
TCTCAAAAGAAGATTCGCTCAATTTAAATAAAATTAATGAGTTAGCATATTTTTCAATAA
TAAGTAAAATTTATAAAAAAAAGGATCTAAAACTGCTTAGCTTCTTGAATTAATGTACAC
TTAGGGAGGTATTAACACTAAGGGTGCTGTTGTTGCTAACGATGTAGACTAAAAAAGAGC
CTACTTACTTACTCATCAAGTTTGTAGAATCAATCCTAGTGGTTTAGTTGTTATTAACCA
TCCTGCTCAATTCTTCCCTACTCTTTAGGACCCCACATCAAATTAAGCTTATGATTAGAA
ATTCTATTTTGACAAAGTTCAAGCTGATGTCCCTTGCTCTGGAGATGGTGCCACAAGAAA
AATTCCCACATAATGGAGAAACTGGAATACCAGAGATGGTCAAGTACTCCATCCTCTTCA
ATTAGCTATTTTGTAAAGAGCTTTAACTCTCTGTAAAGTTGGTGGATATGTTCTTTACTC
TACTTGTTCTATCAACCCTATTGAAGATGAAGCTGTTATAACTGAAGCTTTCCGTAGAGC
TAGTTAAGGATCTATTGAATTAATTGATATTCACACTAAATTCCCAGAACTTAAAGGAAG
AAGAGGTTTATCAAAGTGGACTGTCTGCTCTTCAACTAAAAAGCACCCTGGACATGTAAT
TTACTTATTTAAAAAAAATTGTTAACATTTTATTAAAAAATATTGATAGGATTAAGAAAA
GAAGGAAACTGTAGCTGATTGGTTAAAAATTTATGACAACTTTGAATCTATCGAAAAAAA
TGATAAGCTTGCATAATTCGTTAGAGACTCTATGTTCCCTGAACCTGAAGATAAAATGAC
TAATGAAATTAAAATTTAAAACACCATGCGTATTCTTCCTCATGATTAAGACACTGGTGG
TTTTTACTTAGCCTTAATCAAGAAGAACTCTTTGATCAATTGGAGCAAGAAGGGATTACC
TAAGACTGCTGGCTCTAATAATGAAGAATAATCTGCTTAATAGCAACAAGAGCAACCCGC
TTAATAATAAGTTGTTGATGATTATATTCCTGATGCTAGTGAAATACCCAAAGAAGCTGA
AAGCCTTTAAAACGTAGAAGGAGATGCCCAAGATGGTAAGAAAAATAACAAAAATAAAGA
ACCAGTTCAAAAAGAAAATTTTGTAACCATTCCCGAAGAAGATTGGTAAAATATAAAAGA
AAACTACGGTATTGAAGGTATTGATTAGTCTTTATTCGTAGTTAACACTATTGGAAAGTA
AAAGGTTGTTAGATTAATTACTGAAGGTGCCAAAAAATTCAATGACTGTGATGTTAAAGG
TAAGATTATATATTTGAATTGATTCTATATTTATAACAATTATTTATTGTTTAGGTGTTG
TTAACAAAGTTAACATGGGTACAAAGGCTTTTGAGAGATCAAGAGAAACTTTCTAGGGAA
TTTAATGCAGATTTAGAATTTGCTAAGATTCTGTAAATTTAATTGCTCCTTACATGAGCA
AGAGAAAAATAGTTGTTTCTGAAGATGACTTTAAGTTCTTCGTTTAAAATAAAAACGCTA
AGTATACTGAAATGCCTAATTAAAAATTAAAAGAAGAAATTGCTTAATTAGGCCAAGGAT
CTATTATCCTTCACTGCCCTACCTACAATGATAATCTTGTCTGTTAGAACTTCCATCAAT
CTGTAAATATCATGATTAGTAAGGAAATAACAGAATCATTCAAAATTAGATATCTCAAAT
AATTATTCTGA