Identifiers and Description

Gene Model Identifier

TTHERM_00684490

Standard Name

None

Aliases

PreTt18162 | 104.m00094 | 3732.m00008

Description

DNA repair helicase (rad3)"

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00684490

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17337.19.997093137033517e-262DNA repair helicase (rad3) (10
51 aa)
OxytrichaContig21447.0.g906.996820840887259e-117Helicase C-terminal domain
WormBaseWBGene000091241.0003180480544985e-86locus:rtel-1 Regulator of te
lomere elongation helicase 1 h
omolog status:Confirmed Un
iProt:Q93575 protein_id:CAB0
2102.1
DictyBaseDDB_G02866218.001058982644703e-42fncJ on chromosome: 4 position
4729555 to 4732791
SGDYER171W9.99723014177113e-33RAD3 5 to 3 DNA helicase, invo
lved in nucleotide excision re
pair and transcription; subuni
t of RNA polII initiation fact
or TFIIH and of Nucleotide Exc
ision Repair Factor 3 (NEF3);
homolog of human XPD protein;
mutant has aneuploidy toleranc
e
Stentor CoeruleusSteCoe_281560.000000000000012664165549094176

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00684490(coding)
ATGAATCCAAACTATCCTTCAATTAAAGTTAAGTAGTTAGCTTACCAAAAGAAATTTATC
CAAAGATAAGATAGTTTCTCTTCCTAAACAAATGAAAACTCTCAATAAAGTAGTAAAAGT
TTTAGATCCAAAGATCCTGTTTTGGAGAATACACCTATTCATCTCAACATTTTGCATAAA
GATAAGCATACAAAACTAAATATAAACAATATTGAAGTTTATTTTCCTCATAAACCTTAT
GATGTTTAAGTAGTATACATGGAGAGTGTCATAAAATGTTTATAAGAAAGAACTCACGGT
TTATTAGAATCTCCGACTGGTACAGGAAAAACTTTATCTATGCTTTGTGCGTGTTTAGGA
TGGCTATAATAAAGGAGAGAGTAATAATAAGGAATTAAAGATATTATTCCAAATAGAATT
ATTTATTGCTCTAGAACTCATAGTTAAATATAGCAGGTAGTTAAAGAAATAAAAACAACA
GCTTATTAGCCAAAGATAATAGTGTAAGGTTCAAGAGAGCAGTATTGCATTAAGAAAGAA
TTTTAATAGTTGAAAGGAGGTCTACTAAATACTTCATGCTAAAAAGCAATTAGCCAACTT
AATCCACAAACTTACTGTAGATACTTTAAGGGAACTATGGATGAAAGCAGAGATTTTTTT
AAACTTAGAATGCCAGATATAGAGGACTTAAGAAGTGATGGATATAACAATAATTACTGT
CCCTTTTATCATACCTAGAAAGTTAACAATGCAGTAGATGTTCTTTTTCTTCCATATAAC
TATTTACTTGATAGAAATGTGATGAATTAAGCTAATATAAATATAAAAAACGCTGTAATT
ATATTTGATGAAGCTCACAATATACACAAATCAGCAGAAGAAGGTTATTCTTTGTTTTTA
AACTATTCTTCTTTGTGTGCTGCCGAAGCTGATTTGCTAAATCTTCTTAAGTATATTGAA
AATGGGTATGTAGATGACTAAAATAATTCAACTTCGCCTGCACCTTTAGGTGCTGCAAAA
AGAGGAACACCTATCAAAGAGTTAAGCGAATTCGACACAAAAAATTTTACTAGCTCCTCA
TTTGACTGTAAGGCAATGCTTGGGCCGATTTAGGAATTAAGAAATTATTTTAAACAAATG
GCCTTAAAATAGATAAGAGAAAATTAATAAAACTAGTATAATGAATACAACTGTGATAAT
ATTTAGATTTAGAATGGTAAAGACATATTCGAATTGATCTAAATCCATACAAGAACATCA
AAAGAATAAATTAATGAAAATTCTGTTGATAAATACATGAAGGCTCTTGATAAATAAAAA
GGCACATAATTTGTTTCATTTGAAAACGGATTGAGCTAAAGTAATTTAGCATAATATATA
GACAAAGCTTATAAAGCAATTAAAGACTTGAGTATAGGAGCTTCACATCATGGTCTAGAA
ACTTGGGTCAAATTCTTAGAAGGATTAAAAGATTTATGGACTAGTCACAATGAATTTAAT
TTAAAAACGAAAAAGTCAGACAATCCTTCATAGTTATGTTAAACTAATGATGTCATGCAA
GACTATAAGCTTTATTTTGATTTAGAAGATCCAGAAAATCCATAATTAAATCTTACTTGC
CTTAATCCCAGCTTGAATTTCAAAAAAATTCTTCAGTAAGATCCTCATTGCTTACTTTTT
ACCTCAGGAACATTAAAACCATTTAATTTTTGGAAGACTGAGTTGCAAATTCCATTTAAC
GTAATCCTTGAAAATAAGCATGTCATAGATTCGAAAAAGCAGCTTTTTTCTGCTGTGATA
AAAGGTAGACCTTCAAAATCATCTGTTATCACAACATATAAGCAAACCTTTAACTTTAGC
TATGAAAAAAGAAAGGATTAAGATATGATTTTAGATCTTGGTAATGCTCTAGCTGAACTT
TTTGAAATTATTCCGAATGGTGTTTTAATCGTTTTTCCATCAAATTAACTAATGAATTAG
TGTAGATCTTAATGGTCAAATTTCTTTTCTAATCAAAATAGCAACAATTAATAATAAAAA
ATATACAATCGCTTATTATCAAAGAAATTCATTTACTGGGAAGGAAAAACTAATACTGAA
ACAATGAGTGCTATGTAAGATTTTAGATAAAAGTCAAAAACGTAAAAAGGTTCTGCATTT
TTTTGTGTAGCAAGAGGTAAAATTACAGAAGGTATTGACTTTGCTGATGAATCTGCAAGA
GCAGTTATTTTAATAGGCTTACCATATCCTCCACTTAAAAATATCAATATATAAGTAAAA
AAAGACTATTTAAATCAATAAAGTAAATTAAATTCTTAAAGAATAAATGGAAATGAATGG
TATGTGCAAGAAGCCATCAGAGCGATGAATTAATCCATTGGAAGAGTAATTAGGCATATT
AACGACTGGGGAAGTGTTATATTTTTAGATGAAAGATTTGGACAATAAGATATAATAAAA
CACATGCCTTCTTGGTGCTTAACACAATAAATTGATTCATTTGATTAAGCTCTTATATAG
TTATCGCAATTTTTTAGTGAGAAAAAAATGGCCTCTAAATAAAAATAAGAGGAGCTAAGA
AAATAAATTAACTTAAAGAAAAAAGATAATTTAGAATTAGAATAAGCAGAATAATAATCA
TTTAGTAATACATAAAAACCATAACATGGTATTTAAGTAGTTTAAAAAAGGGCTTTTGAT
TTTACTTCTGTTAAAAGCTTATAAAATTAAATTTAGAAGCCTTAGAAACTTTTTAAATAA
AATATTTTAGTAAGCAAAGATGAGGAATCTCAAAAAAGTTACTAAACACTTGAAAAACCA
GTCTAAAATATAAAAAAGAATCCTTTTTGCTAATCATCTGATGATGAAGAAAACTAACCT
GAGTAAAAATTTTAAATAGTTAAACCTAGTTAATCAATAAAATAAGAAAATAATTAAAAT
ACTACTTCAAGCTAATTTGATTTTTCTAAGCCAATAAAAATAAAATCTTCTTAAGATAAA
ATTATGATTAAAAACGTCTCTTCTAATGTAAATAATTAACAAAATGTAATGAGTACAAAA
AATTCTATTTACACAAATAAAATATTTTTTGAATCTTGA


>TTHERM_00684490(protein)
MNPNYPSIKVKQLAYQKKFIQRQDSFSSQTNENSQQSSKSFRSKDPVLENTPIHLNILHK
DKHTKLNINNIEVYFPHKPYDVQVVYMESVIKCLQERTHGLLESPTGTGKTLSMLCACLG
WLQQRREQQQGIKDIIPNRIIYCSRTHSQIQQVVKEIKTTAYQPKIIVQGSREQYCIKKE
FQQLKGGLLNTSCQKAISQLNPQTYCRYFKGTMDESRDFFKLRMPDIEDLRSDGYNNNYC
PFYHTQKVNNAVDVLFLPYNYLLDRNVMNQANINIKNAVIIFDEAHNIHKSAEEGYSLFL
NYSSLCAAEADLLNLLKYIENGYVDDQNNSTSPAPLGAAKRGTPIKELSEFDTKNFTSSS
FDCKAMLGPIQELRNYFKQMALKQIRENQQNQYNEYNCDNIQIQNGKDIFELIQIHTRTS
KEQINENSVDKYMKALDKQKGTQFVSFENGLSQSNLAQYIDKAYKAIKDLSIGASHHGLE
TWVKFLEGLKDLWTSHNEFNLKTKKSDNPSQLCQTNDVMQDYKLYFDLEDPENPQLNLTC
LNPSLNFKKILQQDPHCLLFTSGTLKPFNFWKTELQIPFNVILENKHVIDSKKQLFSAVI
KGRPSKSSVITTYKQTFNFSYEKRKDQDMILDLGNALAELFEIIPNGVLIVFPSNQLMNQ
CRSQWSNFFSNQNSNNQQQKIYNRLLSKKFIYWEGKTNTETMSAMQDFRQKSKTQKGSAF
FCVARGKITEGIDFADESARAVILIGLPYPPLKNINIQVKKDYLNQQSKLNSQRINGNEW
YVQEAIRAMNQSIGRVIRHINDWGSVIFLDERFGQQDIIKHMPSWCLTQQIDSFDQALIQ
LSQFFSEKKMASKQKQEELRKQINLKKKDNLELEQAEQQSFSNTQKPQHGIQVVQKRAFD
FTSVKSLQNQIQKPQKLFKQNILVSKDEESQKSYQTLEKPVQNIKKNPFCQSSDDEENQP
EQKFQIVKPSQSIKQENNQNTTSSQFDFSKPIKIKSSQDKIMIKNVSSNVNNQQNVMSTK
NSIYTNKIFFES


>TTHERM_00684490(gene)
ATGAATCCAAACTATCCTTCAATTAAAGTTAAGTAGTTAGCTTACCAAAAGAAATTTATC
CAAAGATAAGATAGTTTCTCTTCCTAAACAAATGAAAACTCTCAATAAAGTAGTAAAAGT
TTTAGATCCAAAGATCCTGTTTTGGAGAATACACCTATTCATCTCAACATTTTGCATAAA
GATAAGCATACAAAACTAAATATAAACAATATTGAAGTTTATTTTCCTCATAAACCTTAT
GATGTTTAAGTAGTATACATGGAGAGTGTCATAAAATGTTTATAAGAAAGAACTCACGGT
TTATTAGAATCTCCGACTGGTACAGGAAAAACTTTATCTATGCTTTGTGCGTGTTTAGGA
TGGCTATAATAAAGGAGAGAGTAATAATAAGGAATTAAAGATATTATTCCAAATAGAATT
ATTTATTGCTCTAGAACTCATAGTTAAATATAGCAGGTAGTTAAAGAAATAAAAACAACA
GCTTATTAGCCAAAGATAATAGTGTAAGGTTCAAGAGAGCAGTATTGCATTAAGAAAGAA
TTTTAATAGTTGAAAGGAGGTCTACTAAATACTTCATGCTAAAAAGCAATTAGCCAAGTA
TGCTTTTATTTATTTTAAAATTGTTAATGAATCTAAGATTATTTATTGTTAGTCATAAGC
AATTTTATTTCTTAATTGAATGAATTTTGAAATAATTTTATTTAAAATTTTTTACTTTTA
TATTCTATAGCTTAATCCACAAACTTACTGTAGATACTTTAAGGGAACTATGGATGAAAG
CAGAGATTTTTTTAAACTTAGAATGCCAGATATAGAGGACTTAAGAAGTGATGGATATAA
CAATAATTACTGTCCCTTTTATCATACCTAGAAAGTTAACAATGCAGTAGATGTTCTTTT
TCTTCCATATAACTATTTACTTGATAGAAATGTGATGAATTAAGCTAATATAAATATAAA
AAACGCTGTAATTATATTTGATGAAGCTCACAATATACACAAATCAGCAGAAGAAGGTTA
TTCTTTGTTTTTAAACTATTCTTCTTTGTGTGCTGCCGAAGCTGATTTGCTAAATCTTCT
TAAGTATATTGAAAATGGGTATGTAGATGACTAAAATAATTCAACTTCGCCTGCACCTTT
AGGTGCTGCAAAAAGAGGAACACCTATCAAAGAGTTAAGCGAATTCGACACAAAAAATTT
TACTAGCTCCTCATTTGACTGTAAGGCAATGCTTGGGCCGATTTAGGAATTAAGAAATTA
TTTTAAACAAATGGCCTTAAAATAGATAAGAGAAAATTAATAAAACTAGTATAATGAATA
CAACTGTGATAATATTTAGATTTAGAATGGTAAAGACATATTCGAATTGATCTAAATCCA
TACAAGAACATCAAAAGAATAAATTAATGAAAATTCTGTTGATAAATACATGAAGGCTCT
TGATAAATAAAAAGGCACATAATTTGTTTCATTTGAAAACGGATTGAGCTAAAGTAATTT
AGCATAATATATAGACAAAGCTTATAAAGCAATTAAAGACTTGAGTATAGGAGCTTCACA
TCATGGTCTAGAAACTTGGGTCAAATTCTTAGAAGGATTAAAAGATTTATGGACTAGTCA
CAATGAATTTAATTTAAAAACGAAAAAGTCAGACAATCCTTCATAGTTATGTTAAACTAA
TGATGTCATGCAAGACTATAAGCTTTATTTTGATTTAGAAGATCCAGAAAATCCATAATT
AAATCTTACTTGCCTTAATCCCAGCTTGAATTTCAAAAAAATTCTTCAGTAAGATCCTCA
TTGCTTACTTTTTACCTCAGGAACATTAAAACCATTTAATTTTTGGAAGACTGAGTTGCA
AATTCCATTTAACGTAATCCTTGAAAATAAGCATGTCATAGATTCGAAAAAGCAGCTTTT
TTCTGCTGTGATAAAAGGTAGACCTTCAAAATCATCTGTTATCACAACATATAAGCAAAC
CTTTAACTTTAGCTATGAAAAAAGAAAGGATTAAGATATGATTTTAGATCTTGGTAATGC
TCTAGCTGAACTTTTTGAAATTATTCCGAATGGTGTTTTAATCGTTTTTCCATCAAATTA
ACTAATGAATTAGTGTAGATCTTAATGGTCAAATTTCTTTTCTAATCAAAATAGCAACAA
TTAATAATAAAAAATATACAATCGCTTATTATCAAAGAAATTCATTTACTGGGAAGGAAA
AACTAATACTGAAACAATGAGTGCTATGTAAGATTTTAGATAAAAGTCAAAAACGTAAAA
AGGTTCTGCATTTTTTTGTGTAGCAAGAGGTAAAATTACAGAAGGTATTGACTTTGCTGA
TGAATCTGCAAGAGCAGTTATTTTAATAGGTAAATATTTAAAAAAATCTATTTAATTTTT
AACATATTTATTTTTTACTAGGCTTACCATATCCTCCACTTAAAAATATCAATATATAAG
TAAAAAAAGACTATTTAAATCAATAAAGTAAATTAAATTCTTAAAGAATAAATGGAAATG
AATGGTATGTGCAAGAAGCCATCAGAGCGATGAATTAATCCATTGGAAGAGTAATTAGGC
ATATTAACGACTGGGGAAGTGTTATATTTTTAGATGAAAGATTTGGACAATAAGATATAA
TAAAACACATGCCTTCTTGGTGCTTAACACAATAAATTGATTCATTTGATTAAGCTCTTA
TATAGTTATCGCAATTTTTTAGTGAGAAAAAAATGGCCTCTAAATAAAAATAAGAGGAGC
TAAGAAAATAAATTAACTTAAAGAAAAAAGATAATTTAGAATTAGAATAAGCAGAATAAT
AATCATTTAGTAATACATAAAAACCATAACATGGTATTTAAGTAGTTTAAAAAAGGGCTT
TTGATTTTACTTCTGTTAAAAGCTTATAAAATTAAATTTAGAAGCCTTAGAAACTTTTTA
AATAAAATATTTTAGTAAGCAAAGATGAGGAATCTCAAAAAAGTTACTAAACACTTGAAA
AACCAGTCTAAAATATAAAAAAGAATCCTTTTTGCTAATCATCTGATGATGAAGAAAACT
AACCTGAGTAAAAATTTTAAATAGTTAAACCTAGTTAATCAATAAAATAAGAAAATAATT
AAAATACTACTTCAAGCTAATTTGATTTTTCTAAGCCAATAAAAATAAAATCTTCTTAAG
ATAAAATTATGATTAAAAACGTCTCTTCTAATGTAAATAATTAACAAAATGTAATGAGTA
CAAAAAATTCTATTTACACAAATAAAATATTTTTTGAATCTTGA