Identifiers and Description

Gene Model Identifier

TTHERM_00678460

Standard Name

SCC2 (Sister Chromatid Cohesion protein 2)

Aliases

PreTt07610 | 102.m00130 | 3730.m00057

Description

Cohesin associated protein required for MIC chromosome segregation in mitosis and meiosis. Homolog of the Scc2/NipBL cohesin loading protein.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF07620 ) SLEI
  • ( PF02223 ) thymidylate kinase
  • ( PF00105 ) Zinc finger, C4 type (two
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( PF08360 ) QacR-like protein, C-terminal region

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00678460

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16370.19.997093137033517e-262hypothetical protein (1356 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00678460(coding)
ATGAGCGTGCTCGATGAATGCTTACAAATAATTAATTAATTTACAGAAAAACATACTGGT
AAAGTAAAAGATATAGATCAGTCAGATAAATGTTAGCTGATTAATGATTTAAAATTATAT
TTGTCAAAAATAAATGGAAAAAAGGATATGAACTTAATTGAAAATAGCTTATCTTGCTTG
TAAAAATTGCAAATTTGTCCAAATTAATTAGTTTTTAGCATAGTTTATGAGCTCTATATG
TACTATTTAAGGGTTGAGGAGAGTTCTAAATCTCTAAAGCAAGTAATGAATCATAAACTT
CTTTTAATTTTGAAAAGCAAATACTTAGAAGAGCACCATTTATGCAATATCGTTAATCAC
CTTGATAAGACAACCAGTGTTCTACAGATTCTTTCTCAGCAAGACAAATTATCAGTTTAT
ATATTTTTTTTAGAGAAGATTTTTTAAGGACACTCAAATAACTTAAACGAAGTAATTAGA
ATTTGTAGTAGATTAGCAGCTGAAGATAAAAAGGATTACCTTGAAGGATTAGGATTAATG
ATTGCAACAGAATATTAAGATAATAAGTAATAAAAAATTAAATTAAATAATGGCGAAAGA
ATAGATTGCATTTCGATGCTAATATTTGGGCTAATGAATAAAATTTATAATATTTAAACA
GAACAACAAATTGAAAATGAAAATGAAATATTAGAAATATATAACTTAGCTATCAAGTGT
ATAGATGATTTTCTTAAAAATTTATTTCGCAAAGTAATTGAGGAAGGTAACTAAGCATCT
TCTATTTCAGTAGCTGCTTCCACAAAAAATAAAAAAGAATCACATAAAATACAGCTATTT
TTATTTAACTTTATAAATGATATCTGCAAACAATTATACTCTTAAGAATACTCTATAATA
CCTGTGATATTTAATGTATTTACATCTATACTTAACAGCTACATAAACCTATCTAATTAT
CAAAACAATCACTTTATAATTGATTTGACTAAAAGCATCCTCAAAATCCTTTATAAAGAT
ACATAATAAATAACCCAGTTCAGCTAAGATATGCAGATTATATTCTGCTAAAAAGCTCTC
AAAGGTAAAAAGTCAAAGTACAACGGCTCAGTCTTTTGTAATGTATGTTCAGAAATAGGA
TTTTTTACATTAAAATAAAACGAGCACGAAATATCCTTCTGCTAAGAATGTTCAAACTTA
GAAATAACTTCATAACACATTTCTTAGATAAAAAATTTATCTGATTTATTAATCAAAGAA
TAAATTGCTTTTTTACAAACGTTAACATATCTCTATGCAGATACTCATCATAAAACTCTA
AATATAAACTTCTTGGAGTCTAGGAGCACTAATATTATACTTCACTTTGTCTAACAAGCC
TACAATAAACCAATAAATGCTAAAAATAAAAAAATTACTTTCTTCCTTAACACTCTCACA
TCATAAACTAAATTAGGTAATCCACCAGATTCCCTGGGAAGCACAGAATTAGATTTCCTA
GATTTTATATATAAATCAAAAATACAAACTATGTTTGCAATTCAAGACAAAATTGAATAT
CTATTAAAATATATTTTTGGCCTCACTAACGATAACTCTAGCATAATTAGAAACAAAAGC
TTAACTATTTTAAATGAAATAGAAGGCTTCAATAGATCTCAAAGATTCGAATAATATATT
GATATTCGTAGAAGAGACTAATAAGTGACTGTCAGAATGACTTGTTTGAAAATTTTAGAA
TAGCTTTATATGTCAGAGGATCAAACACAATTTGAAAGTGATATTGAATATAGAGAGAGA
AAAGAAAGATACTTTAAAATGATTATGGACAGATTTAATGATAAAGAAACTTAAGTTAGA
GGGACAGTATTGAGTTTTATCAGCAGTAACTTAAATACTATTGCAAATGATAACCAGTAG
AAGATAAGCTTAATAAAAGAACTTGTGATTAGAGTTTTAAGTGACACTTAGGAATTTCAA
ATATAATCTCTTGATGTTTTAGCAAAAATATACTTCCCATTTTTTTAGGGAAAGCAAGAG
ACAAAAAAGGCAGTGAAAAAGACAAAAAAAGAAACTAAAAAAAACTAAAATATTTTAAAT
ATTGAAGAGGAAAAAACCTTAGAAAACATAATTGAGCTGCAAAAGTTATATGAAATAAAT
ACAGATATTATGGTAAGAATCTTTAGTCATTTCTAAGAGAACCAAAGCGATTCTGCTTCA
ATTCTCAATACAATGCTTTAAATCAGCTTAAAAATATTAGAAGAATTCATTTCAGATAAG
AAAGAGAGAAGATTCATTTTGGAAATTATTGAAGTCCTGTCTAGAATGAAAAATATTTTT
GATATTTATTAAGAGTTTTAAATATTCATTTCATATTTTGATCTGTTAGTTTTAGAAAGA
AATTAAATTCCAATTGCTAATAAAGAACAAAGGGCTGAAACTAATTTATGCATGATAATT
ATTTTAGACATAATAATCAATATGTTTTAAAGAAACTCAATTGTCTCAAACCCTTAAATA
AAAAGTTCAATTTCGAAGATAGAAGATAAGTTACTAAATTTAATTTAGAAAGAGGGAAAT
GTTTAGGTGCTTAAAAAATTAGTCCAATTAAGTGCTTATTCAATAAATTATTCATCTTAG
GATATTCAAAAAATACTAGATATATTTAAGTAGAGATATGCCTTTTTAAAAAATGTATCT
GACATGTAAAACCTCAGCTAAAAGATTAACTTTGGAGACTAAAATGAAAGTGAAATTCTC
ATTTTTAAAATAACTATGAGTATGTATATTGTATCAATTTATTCTTATCACTTTATGAAA
GGTTCATTTTAAGCTCTAAGCATAAACTTAAAAGATGTCCTTGCACTACTTTTATTTTAT
CTCTCTCTACCTAACGAAAGAATTTAGGCTGCTAGCTTTGAAAATATTTCAATGCTTTGG
GAAAAAGAATACGATTTAATTTTTAGTTGCTAAGACATACTCTAAGAAATTATTGTTAGC
AAATCAACTTCTGCTAAACTTTTGATCACAATTTATACAATCTTTGATAAATACATTCTC
AAGCACTCTAACTAAATAAAAAAGAAAATCAACACACAAATTACTGTAAAAAACAGTATG
GTCGAAGAAAGTGAAGAAAATAATCAAAGAAAAAGCATAGACTAAGAATTAGAACACATA
ACATCAATTATTAGGGATTTAACTATTAAGAGCTATGAGCAAGGACTACAAAACCCAGAC
TAAATGGTAAAAAAAACAATCCTAAGGCTTTTAAATCTTTTAGTGAACGAAAATTTAGTT
ATTTTTCAGCAAGTTGGAGCTAATATTATATGTCTTGTATGTGATCCTGATATTTTAATT
AGGACATTAGCTAATTCTATTATCTAAGAGGAATGTTTAAGAAACAAATACTCTATAGAC
AAGTGTTTAAAAGCAGGCTTAAGAAAAAGTGCAGTTTTTATAGATTAGAATTATAAGCAG
TTTACAATAACCGAAGGACCTGAAGATAAGTGCCAATCCCTCTTTGAAAGAATAAACACA
GTGCTAAAATTGAAAGACACTCCTGAAAAGGATACAAATATTTTTGCAAAAAGAGTCTGT
GAAATTTTAAATGAAATAAATGAATGGTCTTATGAAGATCATGAAGTAGCTTTTTTTATT
ATGTAACTTATAATCAGCTTAAATTAAATCACTCATGGAGATATTTTGATATTCCTTAAT
GGAATGAAATCAGTTTCTGACAAGGTTTACTACGAGGTAAAAGATTTCTTAAAGAGAGCC
ATTAATAATCAAATAGACTAATTTGATGAAGAAGACGATTTAGAAAACGAAAAAGCCTTC
ATTAAAACCAATATATTGCTGATGTGTCTCGTTACCAGCCATATTTTGATTATACAGTCT
AGCTTGTCTCTTGGTAAGTACTAGTAGATAGATAGCTTCATTTAAAAACTAAGTTCTTCT
TACCTTGAAGAAACAACTATTTTAGATAATCAGTCTAATAACAGAAACTCTGATCTACAA
TAGCAACTAAAGGTAAAATGGGTTAAGAAATTTAATGGGAACAGAAATCTTTTAGATAAT
TTTTCTGATTTATTTTTGGAGTAAATGAGAGATTTTGATTGCTCAAACGAGGCTTAATTG
AAAATGCTGAGAAAAAAAATAAAGCATTTGTTTTATGATTATGTAGAGAGTGATATTATA
AAAGTTCTTGACTTAACATATACAGACACTGACAAAAACCTTAACTCCGACATGAAAAGT
AAAGAAACAACTAAGCTAAACTAGAGAGGAAAGCCAACGAAGGCATATGATATTTCTAAA
GCAAGTACAAAACATAGAAATATATAAAAGTAGAATTCACACAAATCATCTAATAACAGT
GAATCAAGCTATCATTCATGTAAGGGAAGTAAAAGTTCAAATTATTAAGATCTAGATTAT
AGTGGAGTTTCTCACAAAAGCGCCTCATCCCAAATTTCAAACCCATTCAAAATGAATTTA
AGAAATAGACAAAACGTAAAAAGGTATAGTAAAATTTAAGAAGATTAATCAGATACCTAA
TCAGATGAAGATTCTTAATAAAATTACAAAAATAATAAGGAAAATGACGACTTTGATGAT
GACTATGCTTGA


>TTHERM_00678460(protein)
MSVLDECLQIINQFTEKHTGKVKDIDQSDKCQLINDLKLYLSKINGKKDMNLIENSLSCL
QKLQICPNQLVFSIVYELYMYYLRVEESSKSLKQVMNHKLLLILKSKYLEEHHLCNIVNH
LDKTTSVLQILSQQDKLSVYIFFLEKIFQGHSNNLNEVIRICSRLAAEDKKDYLEGLGLM
IATEYQDNKQQKIKLNNGERIDCISMLIFGLMNKIYNIQTEQQIENENEILEIYNLAIKC
IDDFLKNLFRKVIEEGNQASSISVAASTKNKKESHKIQLFLFNFINDICKQLYSQEYSII
PVIFNVFTSILNSYINLSNYQNNHFIIDLTKSILKILYKDTQQITQFSQDMQIIFCQKAL
KGKKSKYNGSVFCNVCSEIGFFTLKQNEHEISFCQECSNLEITSQHISQIKNLSDLLIKE
QIAFLQTLTYLYADTHHKTLNINFLESRSTNIILHFVQQAYNKPINAKNKKITFFLNTLT
SQTKLGNPPDSLGSTELDFLDFIYKSKIQTMFAIQDKIEYLLKYIFGLTNDNSSIIRNKS
LTILNEIEGFNRSQRFEQYIDIRRRDQQVTVRMTCLKILEQLYMSEDQTQFESDIEYRER
KERYFKMIMDRFNDKETQVRGTVLSFISSNLNTIANDNQQKISLIKELVIRVLSDTQEFQ
IQSLDVLAKIYFPFFQGKQETKKAVKKTKKETKKNQNILNIEEEKTLENIIELQKLYEIN
TDIMVRIFSHFQENQSDSASILNTMLQISLKILEEFISDKKERRFILEIIEVLSRMKNIF
DIYQEFQIFISYFDLLVLERNQIPIANKEQRAETNLCMIIILDIIINMFQRNSIVSNPQI
KSSISKIEDKLLNLIQKEGNVQVLKKLVQLSAYSINYSSQDIQKILDIFKQRYAFLKNVS
DMQNLSQKINFGDQNESEILIFKITMSMYIVSIYSYHFMKGSFQALSINLKDVLALLLFY
LSLPNERIQAASFENISMLWEKEYDLIFSCQDILQEIIVSKSTSAKLLITIYTIFDKYIL
KHSNQIKKKINTQITVKNSMVEESEENNQRKSIDQELEHITSIIRDLTIKSYEQGLQNPD
QMVKKTILRLLNLLVNENLVIFQQVGANIICLVCDPDILIRTLANSIIQEECLRNKYSID
KCLKAGLRKSAVFIDQNYKQFTITEGPEDKCQSLFERINTVLKLKDTPEKDTNIFAKRVC
EILNEINEWSYEDHEVAFFIMQLIISLNQITHGDILIFLNGMKSVSDKVYYEVKDFLKRA
INNQIDQFDEEDDLENEKAFIKTNILLMCLVTSHILIIQSSLSLGKYQQIDSFIQKLSSS
YLEETTILDNQSNNRNSDLQQQLKVKWVKKFNGNRNLLDNFSDLFLEQMRDFDCSNEAQL
KMLRKKIKHLFYDYVESDIIKVLDLTYTDTDKNLNSDMKSKETTKLNQRGKPTKAYDISK
ASTKHRNIQKQNSHKSSNNSESSYHSCKGSKSSNYQDLDYSGVSHKSASSQISNPFKMNL
RNRQNVKRYSKIQEDQSDTQSDEDSQQNYKNNKENDDFDDDYA


>TTHERM_00678460(gene)
ATGAGCGTGCTCGATGAATGCTTACAAATAATTAATTAATTTACAGAAAAACATACTGGT
AAAGTAAAAGATATAGATCAGTCAGATAAATGTTAGCTGATTAATGATTTAAAATTATAT
TTGTCAAAAATAAATGGAAAAAAGGATATGAACTTAATTGAAAATAGCTTATCTTGCTTG
TAAAAATTGCAAATTTGTCCAAATTAATTAGTTTTTAGCATAGTTTATGAGCTCTATATG
TACTATTTAAGGGTTGAGGAGAGTTCTAAATCTCTAAAGCAAGTAATGAATCATAAACTT
CTTTTAATTTTGAAAAGCAAATACTTAGAAGAGCACCATTTATGCAATATCGTTAATCAC
CTTGATAAGACAACCAGTGTTCTACAGATTCTTTCTCAGCAAGACAAATTATCAGTTTAT
ATATTTTTTTTAGAGAAGATTTTTTAAGGACACTCAAATAACTTAAACGAAGTAATTAGA
ATTTGTAGTAGATTAGCAGCTGAAGATAAAAAGGATTACCTTGAAGGATTAGGATTAATG
ATTGCAACAGAATATTAAGATAATAAGTAATAAAAAATTAAATTAAATAATGGCGAAAGA
ATAGATTGCATTTCGATGCTAATATTTGGGCTAATGAATAAAATTTATAATATTTAAACA
GAACAACAAATTGAAAATGAAAATGAAATATTAGAAATATATAACTTAGCTATCAAGTGT
ATAGATGATTTTCTTAAAAATTTATTTCGCAAAGTAATTGAGGAAGGTAACTAAGCATCT
TCTATTTCAGTAGCTGCTTCCACAAAAAATAAAAAAGAATCACATAAAATACAGCTATTT
TTATTTAACTTTATAAATGATATCTGCAAACAATTATACTCTTAAGAATACTCTATAATA
CCTGTGATATTTAATGTATTTACATCTATACTTAACAGCTACATAAACCTATCTAATTAT
CAAAACAATCACTTTATAATTGATTTGACTAAAAGCATCCTCAAAATCCTTTATAAAGAT
ACATAATAAATAACCCAGTTCAGCTAAGATATGCAGATTATATTCTGCTAAAAAGCTCTC
AAAGGTAAAAAGTCAAAGTACAACGGCTCAGTCTTTTGTAATGTATGTTCAGAAATAGGA
TTTTTTACATTAAAATAAAACGAGCACGAAATATCCTTCTGCTAAGAATGTTCAAACTTA
GAAATAACTTCATAACACATTTCTTAGATAAAAAATTTATCTGATTTATTAATCAAAGAA
TAAATTGCTTTTTTACAAACGTTAACATATCTCTATGCAGATACTCATCATAAAACTCTA
AATATAAACTTCTTGGAGTCTAGGAGCACTAATATTATACTTCACTTTGTCTAACAAGCC
TACAATAAACCAATAAATGCTAAAAATAAAAAAATTACTTTCTTCCTTAACACTCTCACA
TCATAAACTAAATTAGGTAATCCACCAGATTCCCTGGGAAGCACAGAATTAGATTTCCTA
GATTTTATATATAAATCAAAAATACAAACTATGTTTGCAATTCAAGACAAAATTGAATAT
CTATTAAAATATATTTTTGGCCTCACTAACGATAACTCTAGCATAATTAGAAACAAAGTA
AAATAAAATTTAATTATATAATCATGCTATTAAACAATAGCCTATTTGTTAATTTTCTTA
TCAATTTTATTAAAATTTTCTGCATTATTAATTCGAATAAATAAAAGCAAACAATTTGTA
ATGCCAATCAAAGAATCTTAAATTTGGTAAACAAATAGTATTGATTGATCAATTTTTTAC
ATTGATACTTAGTTTAATTTTACCATCATTTTTTAGACAAAGTTATTTAGTTTAATTTTT
ATTATAAAAAAATTTGATTTTATTATTTAATGTATTAATTTGAAGATTTTTTAAAATTAC
TAATCAAACAGAGCTTAACTATTTTAAATGAAATAGAAGGCTTCAATAGATCTCAAAGAT
TCGAATAATATATTGATATTCGTAGAAGAGACTAATAAGTGACTGTCAGAATGACTTGTT
TGAAAATTTTAGAATAGCTTTATATGTCAGAGGATCAAACACAATTTGAAAGTGATATTG
AATATAGAGAGAGAAAAGAAAGATACTTTAAAATGATTATGGACAGATTTAATGATAAAG
AAACTTAAGTTAGAGGGACAGTATTGAGTTTTATCAGCAGTAACTTAAATACTATTGCAA
ATGATAACCAGTAGAAGATAAGCTTAATAAAAGAACTTGTGATTAGAGTTTTAAGTGACA
CTTAGGAATTTCAAATATAATCTCTTGATGTTTTAGCAAAAATATACTTCCCATTTTTTT
AGGGAAAGCAAGAGACAAAAAAGGCAGTAAATTAATTAACTAATATTCTAATTTTACTAA
TATTTTAATTATTGGATTTAAATAAGGTGAAAAAGACAAAAAAAGAAACTAAAAAAAACT
AAAATATTTTAAATATTGAAGAGGAAAAAACCTTAGAAAACATAATTGAGCTGCAAAAGT
TATATGAAATAAATACAGATATTATGGTAAGAATCTTTAGTCATTTCTAAGAGAACCAAA
GCGATTCTGCTTCAATTCTCAATACAATGCTTTAAATCAGCTTAAAAATATTAGAAGAAT
TCATTTCAGATAAGAAAGAGAGAAGATTCATTTTGGAAATTATTGAAGTCCTGTCTAGAA
TGAAAAATATTTTTGATATTTATTAAGAGTTTTAAATATTCATTTCATATTTTGATCTGT
TAGTTTTAGAAAGAAATTAAATTCCAATTGCTAATAAAGAACAAAGGGCTGAAACTAATT
TATGCATGATAATTATTTTAGACATAATAATCAATATGTTTTAAAGAAACTCAATTGTCT
CAAACCCTTAAATAAAAAGGTAATAACAAGTCTTTACATTAATCTTGAAAGGCTTTGAAA
AATTTTGAAATTTTATTTAAAAAAAATGAAAAAAGTAATTTTAAATACTTAAAATTTCAA
AAAATTTTTGAATGAAGTCAAATTTTATTTAAAAAATTAAAATTTAAACTTTAAAATTGC
ATGTTTAAAAAAAAAATCATTCTTACATTTTTTAAATGAAAGATACAATTTTTATAAGAT
TTTAATTAGAATAATTTTTAAAAAGATCGCAGTAAAAAATATTTTTATTTATTAAATAGT
TCAATTTCGAAGATAGAAGATAAGTTACTAAATTTAATTTAGAAAGAGGGAAATGTTTAG
GTGCTTAAAAAATTAGTCCAATTAAGTGCTTATTCAATAAATTATTCATCTTAGGATATT
CAAAAAATACTAGATATATTTAAGTAGAGATATGCCTTTTTAAAAAATGTATCTGACATG
TAAAACCTCAGCTAAAAGATTAACTTTGGAGACTAAAATGAAAGTGAAATTCTCATTTTT
AAAATAACTATGAGTATGTATATTGTATCAATTTATTCTTATCACTTTATGAAAGGTTCA
TTTTAAGCTCTAAGCATAAACTTAAAAGATGTCCTTGCACTACTTTTATTTTATCTCTCT
CTACCTAACGAAAGAATTTAGGCTGCTAGCTTTGAAAATATTTCAATGCTTTGGGAAAAA
GAATACGATTTAATTTTTAGTTGCTAAGACATACTCTAAGAAATTATTGTTAGCAAATCA
ACTTCTGCTAAACTTTTGATCACAATTTATACAATCTTTGATAAATACATTCTCAAGCAC
TCTAACTAAATAAAAAAGAAAATCAACACACAAATTACTGTAAAAAACAGTATGGTCGAA
GAGTAAATTTAAATTTCATTTAAATAAAAATTAAAAAGTTTATAGCAATTATTAGCATTT
TATTTATGAAATCAAACAATAAAATATTTTTTTATTCAACATAGAAGTGAAGAAAATAAT
CAAAGAAAAAGCATAGACTAAGAATTAGAACACATAACATCAATTATTAGGGATTTAACT
ATTAAGAGCTATGAGCAAGGACTACAAAACCCAGACTAAATGGTAAAAAAAACAATCCTA
AGGCTTTTAAATCTTTTAGTGAACGAAAATTTAGTTATTTTTCAGCAAGTTGGAGCTAAT
ATTATATGTCTTGTATGTGATCCTGATATTTTAATTAGGACATTAGCTAATTCTATTATC
TAAGAGGAATGTTTAAGAAACAAATACTCTATAGACAAGTGTTTAAAAGCAGGCTTAAGA
AAAAGTGCAGTTTTTATAGATTAGAATTATAAGCAGTTTACAATAACCGAAGGACCTGAA
GATAAGTGCCAATCCCTCTTTGAAAGAATAAACACAGTGCTAAAATTGAAAGACACTCCT
GAAAAGGATACAAATATTTTTGCAAAAAGAGTCTGTGAAATTTTAAATGAAATAAATGAA
TGGTCTTATGAAGATCATGAAGTAGCTTTTTTTATTATGTAACTTATAATCAGCTTAAAT
TAAATCACTCATGGAGATATTTTGATATTCCTTAATGGAATGAAATCAGTTTCTGACAAG
GTTTACTACGAGGTAAAAGATTTCTTAAAGAGAGCCATTAATAATCAAATAGACTAATTT
GATGAAGAAGACGATTTAGAAAACGAAAAAGCCTTCATTAAAACCAATATATTGCTGATG
TGTCTCGTTACCAGCCATATTTTGATTATACAGTCTAGCTTGTCTCTTGGTAAGTACTAG
TAGATAGATAGCTTCATTTAAAAACTAAGTTCTTCTTACCTTGAAGAAACAACTATTTTA
GATAATCAGTCTAATAACAGAAACTCTGATCTACAATAGCAACTAAAGGTAAAATGGGTT
AAGAAATTTAATGGGAACAGAAATCTTTTAGATAATTTTTCTGATTTATTTTTGGAGTAA
ATGAGAGATTTTGATTGCTCAAACGAGGCTTAATTGAAAATGCTGAGAAAAAAAATAAAG
CATTTGTTTTATGATTATGTAGAGAGTGATATTATAAAAGTTCTTGACTTAACATATACA
GACACTGACAAAAACCTTAACTCCGACATGAAAAGTAAAGAAACAACTAAGCTAAACTAG
AGAGGAAAGCCAACGAAGGCATATGATATTTCTAAAGCAAGTACAAAACATAGAAATATA
TAAAAGTAGAATTCACACAAATCATCTAATAACAGTGAATCAAGCTATCATTCATGTAAG
GGAAGTAAAAGTTCAAATTATTAAGATCTAGATTATAGTGGAGTTTCTCACAAAAGCGCC
TCATCCCAAATTTCAAACCCATTCAAAATGAATTTAAGAAATAGACAAAACGTAAAAAGG
TATAGTAAAATTTAAGAAGATTAATCAGATACCTAATCAGATGAAGATTCTTAATAAAAT
TACAAAAATAATAAGGAAAATGACGACTTTGATGATGACTATGCTTGA