Identifiers and Description

Gene Model Identifier

TTHERM_00678310

Standard Name

None

Aliases

PreTt07595 | 102.m00115 | 3730.m00042 | SNR8

Description

Sodium:neurotransmitter symporter family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00209 ) Sodium:neurotransmitter symporter family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12%

TetraMine Data

TTHERM_00678310

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16384.19.997093137033517e-262Sodium:neurotransmitter sympor
ter family protein (589 aa)
WormBaseWBGene000033873.000809166761476e-75locus:mod-5 Transporter st
atus:Confirmed UniProt:Q9N3C
7 protein_id:CCD72993.1

General Information

Paragraph NoGene NameParagraph Text
120TTHERM_00678310The SNR8 protein is homologous to proteins from the APC Superfamily which is associated with the use of cations as substrate to transport solutes. SNR8 contains one domain (Evalue= 4.0e-77) in the Sodium Neurotransmitter Symporter family that is responsible for the reuptake of neurotransmitters in presynaptic terminals. The closest homologs are in Pseudocohnilembus persalinus, a marine ciliate, Paramecium tetraurelia a unicellular organism that feeds on bacteria, with 51% and 42% identical residues. SNR8 may be an essential protein in terminating the presence and thus the effects of signaling molecules in Tetrahymena thermophila. Paragraph by: Benjamin Wolters, Claremont McKenna College.

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00678310(coding)
ATGCATGAAAAATTATTCGGGTAAAAAGAGAGACCAAAGCCGAAGCCTTTAACTCTCTTG
ACAAAAAACGAGTAATATAAATTAGAGCATTGGTATGATGAAAATAAAGATGCTCATGAA
AATAGAGGTGAACATAGAGCTGCATTCAATAGATAATTAGATGAAAATCACCACGAAAGA
GATAGATTTAATAGCTATTATGAATATTTAGTTAGCGTTTTAGGTTTTGCTGCTGGTTTT
GGTAGTGTTTGGAGATTCCCTTACCTTATTTTTAAGAACGGAGGAGGTGTCTTTTTGATT
CCTTACTTTATTTTCCTTTTTTTGATAGGATTTCCATCTTTTTACTTTGAAACTGCAATA
GGATAAATATTTCAAAGAGGTCCTCCACTAATTTTTGAAAAAATTCACAAAAAATGGAAA
GGTTTAGGTATCTTCCCAGTATGCGTGAACTTCTCAATGTCAACTTATTATAATCTAATT
TTAGCATATTCAATATACTTTTTATGGAAGAGTTTTACTTATCCTCTACCTTGGAAGTTA
GAAAACTTAGAAGAGAATCAAAAACCTTGGAATAAAGATTATTTTTACAAAAATTTCTTA
AACTCCTCTAGTGGCCTAGATGAATTAGGTGGAATTGTTTGGCCTATCTTTTTCTGCTAT
TTGTTGTCTTAAGTTATTGTTTATTTCTGCATTCAAAAAGGAGTCTCTGTTTCTGGAAAA
ATAGCATTATTTACTGCCACTTCACCTTATATTTTATTATTTATTTTAATGTTGAGAGGA
TTGTTCTTAGAGGGTGCTTTTACTGGGATTTCTTACTTGTTCTCTCCCGACTGGAGCAAG
TTAAGTGATTTATAGGTTTGGGTTGATGCTGCTAATTAAATTATCTTCCAAGTAAGTACA
GGCTGTGGTGTCTTAATCATCTTTGGTAGTTATAGACCAGTTTCATAAGAAATAAAATAA
ACTTCATATATGGTGCCTATGTTAACAGTTTTATGTGGTTTTCTTGCTTCGTTCGTAATT
TTTAGTTTTATGGGCTATATGTCTCACTTAACTGGCTAATCAATCCAAGATATACCATTA
TCTGGTCCAGATCTTGCTTTTGTAGTGTTTCCAGCAGTCTTAACATTAATGCCTTTCTCA
AATTTGCTGTCAATTATTTTCTTTTTGACCATGGTGTTTTTAGGTATAGACACTTAATTT
GCTTTCATGGATGGACTTGCAGGTTCAATTGAAGACGAATTCCATGGTACTGATGCCAAA
ATATTTAATATAACTATCACTTAAAAGCACATTAGAATGGGAATTTGTAGTATTGTATCC
TTATCTGCTTTTCTATACAGTACTTAAGCAGGTTTTTACTATTTAGAATTTATTGATAGC
TACGGCGTTGGAATTAATTTGATTACTGCAGTGTTTATGGAAGTTTACTTTTTTAATTGG
ATGGAGAACTGGGATACTTTAGAAATCAAGATTACCTAATATATTGGAGAACCAACCCCT
TAGATATATAAAACTTTATTAAAATACTCAGTCCCTGTATTTACAGGTCTTTTGGGAGGA
TTAGCTGTGATACTTTAATTACTAAAAATCAACAAATAAGCCTGGTGGGTTAGTATTATT
GGATGGGCTTTTACACTCTATCCATATTATGCTATATATTACTACTATAAAAAATACAAA
GATGAAAAGCCAATCTAAGGAAAAACTAGTTAAGAAAGGGAAGAATAAGGAAATAAAGAA
CTTGAGTAGGAATTAGTTGAATATTGA


>TTHERM_00678310(protein)
MHEKLFGQKERPKPKPLTLLTKNEQYKLEHWYDENKDAHENRGEHRAAFNRQLDENHHER
DRFNSYYEYLVSVLGFAAGFGSVWRFPYLIFKNGGGVFLIPYFIFLFLIGFPSFYFETAI
GQIFQRGPPLIFEKIHKKWKGLGIFPVCVNFSMSTYYNLILAYSIYFLWKSFTYPLPWKL
ENLEENQKPWNKDYFYKNFLNSSSGLDELGGIVWPIFFCYLLSQVIVYFCIQKGVSVSGK
IALFTATSPYILLFILMLRGLFLEGAFTGISYLFSPDWSKLSDLQVWVDAANQIIFQVST
GCGVLIIFGSYRPVSQEIKQTSYMVPMLTVLCGFLASFVIFSFMGYMSHLTGQSIQDIPL
SGPDLAFVVFPAVLTLMPFSNLLSIIFFLTMVFLGIDTQFAFMDGLAGSIEDEFHGTDAK
IFNITITQKHIRMGICSIVSLSAFLYSTQAGFYYLEFIDSYGVGINLITAVFMEVYFFNW
MENWDTLEIKITQYIGEPTPQIYKTLLKYSVPVFTGLLGGLAVILQLLKINKQAWWVSII
GWAFTLYPYYAIYYYYKKYKDEKPIQGKTSQEREEQGNKELEQELVEY


>TTHERM_00678310(gene)
ATGCATGAAAAATTATTCGGGTAAAAAGAGAGACCAAAGCCGAAGCCTTTAACTCTCTTG
ACAAAAAACGAGTAATATAAATTAGAGCATTGGTATGATGAAAATAAAGATGCTCATGAA
AATAGAGGTGAACATAGAGCTGCATTCAATAGATAATTAGATGAAAATCACCACGAAAGA
GATAGATTTAATAGCTATTATGAATATTTAGTTAGCGTTTTAGGTTTTGCTGCTGGTTTT
GGTAGTGTTTGGAGATTCCCTTACCTTATTTTTAAGAACGGAGGAGGTGTCTTTTTGATT
CCTTACTTTATTTTCCTTTTTTTGATAGGATTTCCATCTTTTTACTTTGAAACTGCAATA
GGATAAATATTTCAAAGAGGTCCTCCACTAATTTTTGAAAAAGTAAATAAATTTAAATTT
TCTAAGGCATTTTCTTAAATATATTACTCAAAGATGACCTAAAAATTAGCAAGCATCCAT
AAAATGTTATATTTTAATAAATTATTAATTAGATTCACAAAAAATGGAAAGGTTTAGGTA
TCTTCCCAGTATGCGTGAACTTCTCAATGTCAACTTATTATAATCTAATTTTAGCATATT
CAATATACTTTTTATGGAAGAGTTTTACTTATCCTCTACCTTGGAAGTTAGAAAACTTAG
AAGAGAATCAAAAACCTTGGAATAAAGTAAAAAATTATTAAGATTTTTCATAATATGATT
AAGCTTTTTGAATATTTTTCTAAAAGTATGATTGATTTTACATTTATAATAAAAGGATTA
TTTTTACAAAAATTTCTTAAACTCCTCTAGTGGCCTAGATGAATTAGGTGGAATTGTTTG
GCCTATCTTTTTCTGCTATTTGTTGTCTTAAGTTATTGTGTAAATATTTAAAAAATTAAT
TTTATACATAAGCTAACTAATTTTGAAAGTAAAAAAACATTCAATAAATGAATGATATGC
CTGTAAACATATCTGATTATGTTATCTTAAAAGAAATACAAAATTTTAAATTATTTCTGA
TCTAAATCAACAATCAAGTTAGTTGAAAAGCTTGGTTTATAGATTTATTTAATTAACTAT
TTTTAAAGTTTTTAATTATCGATAACTGATTAATTATTTAAGATGATCTCTTCTATAATT
AAATACAATACTATAACTTTTTTATTTGAAATTAAAGCCTTACTTATAATAAAATTAATT
TTAATTTATTTTAAAATTACATTAGTTATTTCTGCATTCAAAAAGGAGTCTCTGTTTCTG
GAAAAATAGCATTATTTACTGCCACTTCACCTTATATTTTATTATTTATTTTAATGTTGA
GAGGATTGTTCTTAGAGGGTGCTTTTACTGGGATTTCTTACTTGTTCTCTCCCGACTGGA
GCAAGTTAAGTGATTTATAGGTTTGGGTTGATGCTGCTAATTAAATTATCTTCCAAGTAA
GTACAGGCTGTGGTGTCTTAATCATCTTTGGTAGTTATAGACCAGTTTCATAAGAAATAA
AATAAACTTCATATATGGTGCCTATGTTAACAGTTTTATGTGGTTTTCTTGCTTCGTTCG
TAATTTTTAGTTTTATGGGCTATATGTCTCACTTAACTGGCTAATCAATCCAAGATATAC
CATTATCTGGTCCAGATCTTGCTTTTGTAGTGTTTCCAGCAGTCTTAACATTAATGCCTT
TCTCAAATTTGCTGTCAATTATTTTCTTTTTGACCATGGTGTTTTTAGGTATTTTAAATG
TTTTTATTTTCAATTTATAAATTTATAATATCATTAACTATAAATAGTTGTGGTAGATAG
ATTATTATTATTTAAAAAATAAATATGTTTTATTGATTAATTAGGTATAGACACTTAATT
TGCTTTCATGGATGGACTTGCAGGTTCAATTGAAGACGAATTCCATGGTACTGATGCCAA
AATATTTAATATAACTATCACTTAAAAGCACATTAGAATGGGAATTTGTAGTATTGTATC
CTTATCTGCTTTTCTATACAGTACTTAAGCAGGTTTTTACTATTTAGAATTTATTGATAG
CTACGGCGTTGGAATTAATTTGATTACTGCAGTGTTTATGGAAGTTTACTTTTTTAATTG
GATGGAGAACTGGGATACTTTAGAAATCAAGATTACCTAATATATTGGAGAACCAACCCC
TTAGATATATAAAACTTTATTAAAATACTCAGTCCCTGTATTTACAGGTCTTTTGGGAGG
ATTAGCTGTGATACTTTAATTACTAAAAATCAACAAATAAGCCTGGTGGGTTAGTATTAT
TGGATGGGCTTTTACACTCTATCCATATTATGCTATATATTACTACTATAAAAAATACAA
AGATGAAAAGCCAATCTAAGGAAAAACTAGTTAAGAAAGGGAAGAATAAGGAAATAAAGA
ACTTGAGTAGGAATTAGTTGAATATTGA