Identifiers and Description

Gene Model Identifier

TTHERM_00670700

Standard Name

None

Aliases

PreTt01094 | 100.m00155 | 3731.m00065

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00670700

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16484.11.999489510516749e-128hypothetical protein (200 aa)
OxytrichaContig14684.0.g274.0002685161515803e-16DDE_Tnp_1-like zinc-ribbon
Stentor CoeruleusSteCoe_283170.00000004139937718785167

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00670700(coding)
ATGGAAGATGAAAGTGAAATTCTGAAGAGATACGCAAATAAAACAAACATAGGAAAGGAT
GAAACCATAACATTAGCATCTTTAAAATAACAAGCAAACAAACTGACTGAAGAAAAAAAG
AAGGAACAAAGAATTAATTTTAAAATATATAGTTCAGATGAAGCAGGATAAGAAAAATTA
GATTTATAATAGTACTTTTGTGCTCTTTGTGGAAAATTTATTATTGCAACTAATATAAAA
TTAGAAGTTTTGCCAATTAGAGCAACTGATCAAGCAATTGCAGTTGATCTTTAAAGAGTG
TTTGTTAAGCATTTTTTGATTAAAGAAGGGTTAAAGAACATCAAAAGAGAATATGGTATG
GAATAATAGTTTAGATGGAAGTGTCATTGTGATATAACAATTGCTTATTAATCAATAAGA
TATGATGAATCTGAAAAAATATACGAAGAAATGCACATTAAAAGAAATAAATAATTTTAG
GGATTTTAAGTTAGCAATAAACCATTCCTGTACATAATAAATGATGCAATAGTAATGGAA
GCTAAGGATTCAAGATTAGTCAAAGAAATATTATCTAAAAACCCAGACTTGGTCTACTGA


>TTHERM_00670700(protein)
MEDESEILKRYANKTNIGKDETITLASLKQQANKLTEEKKKEQRINFKIYSSDEAGQEKL
DLQQYFCALCGKFIIATNIKLEVLPIRATDQAIAVDLQRVFVKHFLIKEGLKNIKREYGM
EQQFRWKCHCDITIAYQSIRYDESEKIYEEMHIKRNKQFQGFQVSNKPFLYIINDAIVME
AKDSRLVKEILSKNPDLVY


>TTHERM_00670700(gene)
ATGGAAGATGAAAGTGAAATTCTGAAGAGATACGCAAATAAAACAAACATAGGAAAGGAT
GAAACCATAACATTAGCATCTTTAAAATAACAAGCAAACAAACTGACTGAAGAAAAAAAG
AAGGAACAAAGAATTAATGTAAGAAAAAAAATATTAAATAAAATAAACATGTGATATCAC
TTAAAAATAGTTTAAAATATATAGTTCAGATGAAGCAGGATAAGAAAAATTAGATTTATA
ATAGTACTTTTGTGCTCTTTGTGGAAAATTTATTATTGCAACTAATATAAAATTAGAAGT
TTTGCCAATTAGAGCAACTGATCAAGCGTAAATAAATAAATATTCTATAATCTCTACTCA
TTAGCTTCTAAATAAAATAAATAAATATCGTATTATTAAATAGAATTGCAGTTGATCTTT
AAAGAGTGTTTGTTAAGCATTTTTTGATTAAAGAAGGGTTAAAGAACATCAAAAGAGAAT
ATGGTAAAAATATTATTCAAATCATATATGTTTTAAGTATTAAACTATTTTTATCAAAAA
ATAATACTAGGTATGGAATAATAGTTTAGATGGAAGTGTCATTGTGATATAACAATTGCT
TATTAATCAATAAGATATGATGAATCTGAAAAAATATACGAAGAAATGCACATTAAAAGA
AATAAATAATTTTAGGGATTTTAAGTTAGCAATAAACCATTCCTGTACATAATAAATGAT
GCAATAGTAATGGAAGCTAAGGATTCAAGATTAGTCAAAGAAATATTATCTAAAAACCCA
GACTTGGTCTACTGA