Identifiers and Description

Gene Model Identifier

TTHERM_00670170

Standard Name

None

Aliases

PreTt01041 | 100.m00102 | 3731.m00012

Description

ribosomal protein S9; ribosomal protein S9 containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.9%

TetraMine Data

TTHERM_00670170

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16431.19.997093137033517e-262ribosomal protein S9 containin
g protein (737 aa)
OxytrichaContig14282.0.g822.000130478826482e-26Ribosomal protein S9/S16
DictyBaseDDB_G02928820.0000000000000030004923591262316DDB_G0292882 on chromosome: 6
position 2208837 to 2209856
Stentor CoeruleusSteCoe_10880.0000000000006914400106940203
SGDYBR146W0.000000000003001226732525078MRPS9 Mitochondrial ribosomal
protein of the small subunit
WormBaseWBGene000044850.00020003864201578029locus:rps-16 40S ribosomal p
rotein S16 status:Confirmed
UniProt:Q22054 protein_id:
CAB01658.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00670170(coding)
ATGATGCTAATTAGAAAATCTTTAGCTATCAGCTAAACTTAAAATATTTTAAAAGGCTTG
TTTAGTGTTAGGAATTCTAAAGCTGCTTAGCATTAGATTAGAAGCAGAAATTTTTTTGAA
GTTGATCCTATATTCCCTGATGGTAAGGACGATGAATCTAAATTATACAGAGATTTTGAA
AGAACCAAATTTGGATCTAATCAAAGAGACTAAAGAATTATTTTTGAAAGACATACCAGC
CACATGATGAAGAGAATAAATCAATCTCTTGAAAGAGAAGAAAAAATTAAAAAATTAAAA
GGAAGACAATATAAAAAATAAAAAGAAGAAGTTTAAGCTATTGCTGAAAATGTATTTTTG
GATGAGGAAACTAAGTTACCTTATGGTATTGGATTAGATGATTATATTGAACTTATCAAA
GAAGAATCAATTACAACTAAGACTGGTTAGTTCTACAGCACTTTAGAAGTTATATGTAGA
AAAATTGGTGCTTACAACGATGTTGAACTTGTTAAATTATATCAATTTATTCTTGCTGAA
AAGGTTGCTGATTCCTTCAAAAATGAAGCTCGTTAATTCTTGCTTAAACGTCTTATCCAA
GAAATCCAAAAGCTTGGCTGGAATTCATAATAGGCCAAATCCAAGCTTTCAAGCTATTTA
GATTCTTCAAAGGCTAGCAACGAATTTGTCGAAAATGCCTTAAAGGAGGGCAACTCTGAA
GGATTTGCACAAACTATTTCCACCTTATTTAAGGAAGAGTTAATTTCTTAAGAAGCTAAG
AATCGTGCTATTACCAACATTTAAGAAAAAATTCGTTTCAACACAAATTTAAAGAGGGTT
AAGTAGCCACCAAGAAGAATTGATTAAGATGATCCATTCTTCTCTGAAGAAAGTGATTCA
GAATCAAACTTTTCTGAACCTCTCTTCAACTTTGAAGACAAAAAAGCTACAGTTAAAGAT
CTTGTAGATCCTTTCATTACTTAAGGTAGAAAATAATTGGAAACCTAATTGATTTGGGCG
AAAGTTAAATAAAACTATTATGATAACAAGAGAAAGTTTTATAAGGAAAAAATGTATACT
GAAGAAGATAAAAGCAAAGAAGTAGTTAAAAAAGATATGACTCTTAATGTTATTGACTTC
TTAATTGATTCCAAGGATGAATAAGAAATCAAAACAATTCTTGATAAGTACAACCTCGTT
GATGAGGTTATCCCAAAACCTGAATTTAAAGAAATCTTGAAAAACATCGATTACCTTGTT
GATTAAGCCTCTACCTCTATTAAGGTTTAGATCGCTAAAGAAAAGAACCAAAATAAAGAC
TTATATTTTAGAGGAAACTTCTTACAAGAAAATTTAAAGCCTGAAGATTTGATGTGGAAA
CACTTCCATAATAACTTCGTTTCTATCTTCCCAGAAAGCATGCCCGAATAAGAATAAATC
AGTTAGTCTGTTCAAAATGAAAACGATATCAGATTCCACCCTAAAGAATTAGATATTGTT
GATTATGGTAGCAGCAATTCAAAGGAATAAGAAAATAGAAAACGTGGTGAAAGAGATCTT
TCTAAGGATAATTAAATCGAAATTGAACTTTATAGAAGAATTAAGACTGACCCATTCTTC
AGACATTATATTTAGAACGAAATTAAATATTTCACTGAAAGAATCGAAGACGGTGTACTT
GATATTGCTTAAGTCATTGTTCCTGCTGATAGAAAGAATGATACACCCTTCTATTACGAT
CCAACTTTAGAAGATATCCCTCTTGATTTGATTGATGATGAATAATTAAGAATGAAATAC
TAAAAACTTAAAAAAGAAAAAGATCAAGGAATTAAAGTATTTGCTTCTGGTAAAAGAAAA
ACTTCTAGTTGCCTTGTAGTGATTAAAGAAGGTACAGGAAAAGTATTTGTTAACAATGAA
ATTTTCTATCGTTACTTTACTCATTCATACAACAGAAATATTGCCTTAAAGCCTATGCTA
CTATCCACCCAATATTGTGAGTATGACCTCCATTTCTACGTTAGAGGTGGTGGTGTTATG
GGTCAATCTCATGCTTGCCAAATTGCTCTTGCTAGAGGTCTCACTTAAATACATCCCAAC
CTTAGACCTATCTTCATGAAATTTGATTTACTTCGTACTGATTACAGACAAAAGGAAAGA
AAGAAAACTGGTAGATATAAAGCCAGAAAAGCTCACACTTACGTTAGACGTTGA


>TTHERM_00670170(protein)
MMLIRKSLAISQTQNILKGLFSVRNSKAAQHQIRSRNFFEVDPIFPDGKDDESKLYRDFE
RTKFGSNQRDQRIIFERHTSHMMKRINQSLEREEKIKKLKGRQYKKQKEEVQAIAENVFL
DEETKLPYGIGLDDYIELIKEESITTKTGQFYSTLEVICRKIGAYNDVELVKLYQFILAE
KVADSFKNEARQFLLKRLIQEIQKLGWNSQQAKSKLSSYLDSSKASNEFVENALKEGNSE
GFAQTISTLFKEELISQEAKNRAITNIQEKIRFNTNLKRVKQPPRRIDQDDPFFSEESDS
ESNFSEPLFNFEDKKATVKDLVDPFITQGRKQLETQLIWAKVKQNYYDNKRKFYKEKMYT
EEDKSKEVVKKDMTLNVIDFLIDSKDEQEIKTILDKYNLVDEVIPKPEFKEILKNIDYLV
DQASTSIKVQIAKEKNQNKDLYFRGNFLQENLKPEDLMWKHFHNNFVSIFPESMPEQEQI
SQSVQNENDIRFHPKELDIVDYGSSNSKEQENRKRGERDLSKDNQIEIELYRRIKTDPFF
RHYIQNEIKYFTERIEDGVLDIAQVIVPADRKNDTPFYYDPTLEDIPLDLIDDEQLRMKY
QKLKKEKDQGIKVFASGKRKTSSCLVVIKEGTGKVFVNNEIFYRYFTHSYNRNIALKPML
LSTQYCEYDLHFYVRGGGVMGQSHACQIALARGLTQIHPNLRPIFMKFDLLRTDYRQKER
KKTGRYKARKAHTYVRR


>TTHERM_00670170(gene)
ATGATGCTAATTAGAAAATCTTTAGCTATCAGCTAAACTTAAAATATTTTAAAAGGCTTG
TTTAGTGTTAGGAATTCTAAAGCTGCTTAGCATTAGATTAGAAGCAGAAATTTTTTTGAA
GTTGATCCTATATTCCCTGGTATGATAATTTAGTATACAAATATATATGCAAATTTAAAT
CTCTATGAAATATATCAATGAGAATGTTCTTAAATAGAGAGCAATACAGTTATTTAAGGC
TTTTAAATTAGAAAATATTAGCAAATCAGATACTTAACATGAAAACGCAATTAAAATTTT
AACGAATTTATTGTTTTATAAAAAGATGGTAAGGACGATGAATCTAAATTATACAGAGAT
TTTGAAAGAACCAAATTTGGATCTAATCAAAGAGACTAAAGAATGTAGAAATTATATAAC
TTTTGTTTCAAATAAAATATTTTAAGCTTCACATAAGATGAATATAATTAGAATATTAGG
AGCAAATTAAAATATTAATTAGATTTTTTGTAAGCAAAATGCAAAATAAAACGCATTTGT
TTCCAATTTACATTTTAAATCTAATTAATTTAAAAGAAAATTTATAATATTTTTGTTCTC
CTTTGATGCATAAGGTAGACTTGTGTGAGTTTATGCAAACTAATTATAGGATTCTTTATT
ATAGAAGGCACTAATTAATATTAATGATAAATACAATAAAATTTCAGAATGTTAGTTGGT
TTGCTTATTTAAATTTTTTGATAAAATAGTATTTTTGAAAGACATACCAGCCACATGATG
AAGAGAATAAATCAATCTCTTGAAAGAGAAGAAAAAATTAAAAAATTAAAAGGAAGACAA
TATAAAAAATAAAAAGAAGAAGTTTAAGCTATTGCTGAAAATGTATTTTTGGATGAGGAA
ACTAAGTTACCTTATGGTATTGGATTAGATGATTATATTGAACTTATCAAAGAAGAATCA
ATTACAACTAAGACTGGTTAGTTCTACAGCACTTTAGAAGTTATATGTAGAAAAATTGGT
GCTTACAACGATGTTGAACTTGTTAAATTATATCAATTTATTCTTGCTGAAAAGGTTGCT
GATTCCTTCAAAAATGAAGCTCGTTAATTCTTGCTTAAACGTCTTATCCAAGAAATCCAA
AAGCTTGGCTGGAATTCATAATAGGCCAAATCCAAGCTTTCAAGCTATTTAGATTCTTCA
AAGGCTAGCAACGAATTTGTCGAAAATGCCTTAAAGGAGGGCAACTCTGAAGGATTTGCA
CAAACTATTTCCACCTTATTTAAGGAAGAGTTAATTTCTTAAGAAGCTAAGAATCGTGCT
ATTACCAACATTTAAGAAAAAATTCGTTTCAACACAAGTAACTAATTTTTTCATTTATTT
TAATTATAAAATATCTTCAACCAACATTGATTTTTACTTATAGCATGCTTGTGTGCTAAA
TTAATTTTTATAAAAAAGATTTAAAGAGGGTTAAGTAGCCACCAAGAAGAATTGATTAAG
ATGATCCATTCTTCTCTGAAGAAAGTGATTCAGAATCAAACTTTTCTGAACCTCTCTTCA
ACTTTGAAGACAAAAAAGCTACAGTTAAAGATCTTGTAGATCCTTTCATTACTTAAGGTA
GAAAATAATTGGAAACCTAATTGATTTGGGCGAAAGTTAAATAAAACTATTATGATAACA
AGAGAAAGTTTTATAAGGAAAAAATGTATACTGAAGAAGATAAAAGCAAAGAAGTAGTTA
AAAAAGATATGACTCTTAATGTTATTGACTTCTTAATTGATTCCAAGGGTAAAATTAGTT
TGAACAATAAAGAATAACTTTTTAAAATAAATAAATAAATACAAAAAGATGAATAAGAAA
TCAAAACAATTCTTGATAAGTACAACCTCGTTGATGAGGTTATCCCAAAACCTGAATTTA
AAGAAATCTTGAAAAACATCGATTACCTTGTTGATTAAGCCTCTACCTCTATTAAGGTTT
AGATCGCTAAAGAAAAGAACCAAAATAAAGACTTATATTTTAGAGGAAAGTATGAAATTT
ATCAAATATTTATATATTTTTTAGTAAAAATATTAATTATAGTTAAATATTTCTTCATTT
TAAATATAGCTTCTTACAAGAAAATTTAAAGCCTGAAGATTTGATGTGGAAACACTTCCA
TAATAACTTCGTTTCTATCTTCCCAGAAAGCATGCCCGAATAAGAATAAATCAGTTAGTC
TGTTCAAAATGAAAACGATATCAGATTCCACCCTAAAGAATTAGATATGTAAGTGAGCAA
ATTAAAATAAAACAAACAAATTTTTACTATTTAAATTTGATGATGATTTACTTTAAATTG
ATTTTAATTTAATCAATTAAAATATTTTGTTAAGTTTGTTATTTCAAAATAATTAAACAT
TATATTAAAAATAAATATTAATTAATTTATTTAAAAAGTGTTGATTATGGTAGCAGCAAT
TCAAAGGAATAAGAAAATAGAAAACGTGGTGAAAGAGATCTTTCTAAGGATAATTAAATC
GAAATTGAACTTTATAGAAGAATTAAGACTGACCCATTCTTCAGACATTATATTTAGAAC
GAAATTAAATATTTCACTGAAAGAATCGAAGACGGTGTACTTGATATTGCTTAAGTCATT
GTTCCTGCTGATGTAAAAAATTTAAATTTAACTAAATTGGCATGCTTAGTTTTTTGTTTT
AAATATTATAGAGAAAGAATGATACACCCTTCTATTACGATCCAACTTTAGAAGATATCC
CTCTTGATTTGATTGATGATGAATAATTAAGAATGAAATACTAAAAACTTAAAAAAGAAA
AAGATCAAGGAATTAAAGTATTTGCTTCTGGTAAAAGAAAAACTTCTAGTTGCCTTGTAG
TGATTAAAGAAGGTACAGGAAAAGTATTTGTTAACAATGAAATTTTCTATCGTTACTTTA
CTCATTCATACAACAGAAATATTGCCTTAAAGCCTATGCTACTATCCACCCAATATTGTG
AGTATGACCTCCATTTCTACGTTAGAGGTGGTGGTGTTATGGGTCAATCTCATGCTTGCC
AAATTGCTCTTGCTAGAGGTCTCACTTAAATACATCCCAACCTTAGACCTATCTTCATGA
AATGTAATTAATTTTATTCAATTAAGTTTTTTTCTAAATTTTTTGTTTTTAAATAGTTGA
TTTACTTCGTACTGATTACAGACAAAAGGAAAGAAAGAAAACTGGTAGATATAAAGCCAG
AAAAGCTCACACTTACGTTAGACGTTGA