Identifiers and Description

Gene Model Identifier

TTHERM_00663829

Standard Name

None

Aliases

3736.m00679

Description

histone deacetylase 1, 2 ,3

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00850 ) Histone deacetylase family

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17203.19.99709313703352e-262histone deacetylase 1, 2,3...
OxytrichaContig1866.0.g687.0032991507405e-122Histone deacetylase domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00663829(protein)
METKKKVAYFYNNEIGNYNYGKLHLMNPKRISMTHSLIVGYGVYKDLDVYTTREATKEEI
MQFHDQDYVEYLSNYVSSSKIDFLKKNGCSIPLIDEDAKNDSDKKKQYGIDVQADCPGFD
GLYTFSQLSTGGGSIDAAHLIINNAADIAINWGGGLHHAKKGEAYGFCYVNDIVICILEL
LKVFPRVLYIDIDVHHGDGVEEAFYTTNRVMTVSFHEFGEDFFPGTGGLNSNGEGLGKNY
AVNVPLRPGMDDESYVQLFKNVMNKVMEVYRPDVVVFQTGADSLANDKIGHFNLSIKGHG
QCLTYMMGFNVPLVVLGGGGYTIQNVSRCWAFETGLLVKKSLNGPIPVDDPFFHLYEKQN
VLHVPIQQVENKNSKEDLNKIQEEIFKQLKDVEAAPGVPFHTVPRTFLYDDEEYFDEHEM
DKNHDYDGNNYDQDKLNDYINGYHQMDIEQNDQNEIIRKSPLLIEKRNKFNHI


>TTHERM_00663829(coding)
ATGGAGACTAAAAAAAAAGTAGCATATTTTTACAATAATGAAATTGGAAATTATAACTAT
GGTAAGCTGCATTTGATGAATCCTAAGAGAATTTCTATGACTCACTCTTTGATTGTTGGA
TACGGAGTTTACAAAGATCTTGATGTTTATACCACAAGAGAAGCAACAAAAGAAGAAATT
ATGCAATTTCATGATTAAGATTATGTTGAATACCTCTCTAACTATGTTTCAAGCTCTAAG
ATAGATTTTCTGAAGAAAAATGGATGCAGTATACCTTTAATAGATGAAGATGCAAAAAAT
GATAGTGATAAAAAGAAGTAATATGGTATTGATGTATAAGCGGACTGCCCAGGTTTTGAT
GGACTCTATACTTTTAGTCAGCTCTCAACAGGTGGTGGCTCTATCGATGCGGCTCATTTG
ATCATAAATAATGCAGCTGATATTGCTATTAACTGGGGAGGAGGTTTGCATCATGCGAAA
AAAGGAGAAGCATATGGATTTTGCTATGTAAACGATATAGTTATATGTATTCTTGAACTT
TTAAAAGTCTTTCCACGTGTTTTATATATTGATATCGATGTTCACCATGGTGATGGTGTT
GAAGAAGCTTTCTATACAACTAACCGTGTAATGACTGTAAGTTTTCATGAGTTTGGTGAG
GATTTCTTCCCAGGGACAGGAGGATTAAATAGCAATGGAGAAGGTTTAGGTAAAAACTAT
GCAGTGAATGTACCTTTGAGACCTGGTATGGATGACGAAAGTTATGTTTAATTATTTAAA
AATGTCATGAACAAAGTTATGGAAGTATATAGACCTGATGTTGTAGTATTTTAAACAGGA
GCTGATAGCTTAGCAAATGATAAAATAGGTCATTTTAACCTTTCTATAAAAGGTCATGGA
TAGTGCTTAACATATATGATGGGCTTTAATGTACCTCTTGTAGTATTAGGAGGAGGTGGA
TACACTATTTAAAATGTTAGTCGTTGTTGGGCATTTGAAACAGGACTGTTAGTTAAAAAA
AGTCTTAATGGTCCCATACCTGTTGATGACCCTTTCTTCCATTTATACGAAAAATAGAAT
GTGTTGCATGTCCCTATATAGTAAGTAGAAAATAAAAATAGTAAAGAAGACTTAAATAAA
ATTTAAGAAGAAATATTCAAACAGCTTAAAGATGTTGAAGCTGCTCCTGGAGTTCCCTTC
CACACAGTTCCTCGCACATTTTTGTATGATGATGAGGAATACTTTGATGAGCATGAAATG
GATAAAAATCATGATTATGATGGAAATAACTATGATTAAGATAAGCTCAACGATTATATT
AATGGCTACCACTAAATGGATATTGAGTAAAATGATTAGAATGAAATAATTAGAAAGTCA
CCACTGCTCATTGAAAAAAGAAATAAATTTAATCATATTTGA


>TTHERM_00663829(gene)
ATGGAGACTAAAAAAAAAGTAGCATATTTTTACAATAATGAAATTGGAAATTATAACTAT
GGTAAGCTGCATTTGATGAATCCTAAGAGAATTTCTATGACTCACTCTTTGATTGTTGGA
TACGGAGTTTACAAAGATCTTGATGTTTATACCACAAGAGAAGCAACAAAAGAAGAAATT
ATGCAATTTCATGATTAAGATTATGTTGAATACCTCTCTAACTATGTTTCAAGCTCTAAG
ATAGATTTTCTGAAGAAAAATGGATGCAGTATACCTTTAATAGATGAAGATGCAAAAAAT
GATAGTGATAAAAAGAAGTAATATGGTATTGATGTATAAGCGGACTGCCCAGGTTTTGAT
GGACTCTATACTTTTAGTCAGCTCTCAACAGGTGGTTACTCAATAATTTATTTTTAATTT
TTTTTATTAAATACTCTAGGAAATAAAATGTATTATTAAATAATATTCACAATATTTTGG
ATCATCAAGCTATTTAAGCTTTTTTTTCTCTACTTTTTCTTTGATTGTTTAGAAGAATAT
AAGCAGCCTACTTTAATAATAATTTAGTTATATATTAATATTAATAGAGATTGGTTTTAA
ATCATAGATATATATACTAAATTATGATGATTAATTTTTTTAAGTATTTAAGTTAAAGTT
ATATATTTAAAATAAGGTGGCTCTATCGATGCGGCTCATTTGATCATAAATAATGCAGCT
GATATTGCTATTAACTGGGGAGGAGGTTTGCATCATGCGAAAAAAGGAGAAGCATATGGA
TTTTGCTATGTAAACGATATAGTTATATGTATTCTTGAACTTTTAAAAGTCTTTCCACGT
GTTTTATATATTGATATCGATGTTCACCATGGTGATGGTGTTGAAGAAGCTTTCTATACA
ACTAACCGTGTAATGACTGTAAGTTTTCATGAGTTTGGTGAGGATTTCTTCCCAGGGACA
GGAGGATTAAATAGCAATGGAGAAGGTTTAGGTAAAAACTATGCAGTGAATGTACCTTTG
AGACCTGGTATGGATGACGAAAGTTATGTTTAATTATTTAAAAATGTCATGAACAAAGTT
ATGGAAGTATATAGACCTGATGTTGTAGTATTTTAAACAGGAGCTGATAGCTTAGCAAAT
GATAAAATAGGTCATTTTAACCTTTCTATAAAAGGTCATGGATAGTGCTTAACATATATG
ATGGGCTTTAATGTACCTCTTGTAGTATTAGGAGGAGGTGGATACACTATTTAAAATGTT
AGTCGTTGTTGGGCATTTGAAACAGGACTGTTAGTTAAAAAAAGTCTTAATGGTCCCATA
CCTGTTGATGACCCTTTCTTCCATTTATACGAAAAATAGAATGTGTTGCATGTCCCTATA
TAGTAAGTAGAAAATAAAAATAGTAAAGAAGACTTAAATAAAATTTAAGAAGAAATATTC
AAACAGCTTAAAGATGTTGAAGCTGCTCCTGGAGTTCCCTTCCACACAGTTCCTCGCACA
TTTTTGTATGATGATGAGGAATACTTTGATGAGCATGAAATGGATAAAAATCATGATTAT
GATGGAAATAACTATGATTAAGATAAGCTCAACGATTATATTAATGGCTACCACTAAATG
GATATTGAGTAAAATGATTAGAATGAAATAATTAGAAAGTCACCACTGCTCATTGAAAAA
AGAAATAAATTTAATCATATTTGA