Identifiers and Description

Gene Model Identifier

TTHERM_00663829

Standard Name

None

Aliases

3736.m00679

Description

histone deacetylase 1, 2 ,3

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00850 ) Histone deacetylase family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17203.19.997093137033517e-262histone deacetylase 1, 2,3 (47
3 aa)
DictyBaseDDB_G02680246.0023901016598e-137hdaA on chromosome: 1 position
1320084 to 1322172
SGDYNL330C7.0034470334661e-134RPD3 Histone deacetylase; regu
lates transcription, silencing
, and other processes by influ
encing chromatin remodeling; f
orms at least two different co
mplexes which have distinct fu
nctions and members
WormBaseWBGene000018342.0001701965494945e-132locus:hda-1 Histone deacetyl
ase 1 status:Confirmed Uni
Prot:O17695 protein_id:CAB03
984.1
OxytrichaContig1866.0.g689.999664388307901e-124Histone deacetylase domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00663829(protein)
METKKKVAYFYNNEIGNYNYGKLHLMNPKRISMTHSLIVGYGVYKDLDVYTTREATKEEI
MQFHDQDYVEYLSNYVSSSKIDFLKKNGCSIPLIDEDAKNDSDKKKQYGIDVQADCPGFD
GLYTFSQLSTGGSIDAAHLIINNAADIAINWGGGLHHAKKGEAYGFCYVNDIVICILELL
KVFPRVLYIDIDVHHGDGVEEAFYTTNRVMTVSFHEFGEDFFPGTGGLNSNGEGLGKNYA
VNVPLRPGMDDESYVQLFKNVMNKVMEVYRPDVVVFQTGADSLANDKIGHFNLSIKGHGQ
CLTYMMGFNVPLVVLGGGGYTIQNVSRCWAFETGLLVKKSLNGPIPVDDPFFHLYEKQNV
LHVPIQQVENKNSKEDLNKIQEEIFKQLKDVEAAPGVPFHTVPRTFLYDDEEYFDEHEMD
KNHDYDGNNYDQDKLNDYINGYHQMDIEQNDQNEIIRKSPLLIEKRNKFNHI


>TTHERM_00663829(coding)
ATGGAGACTAAAAAAAAAGTAGCATATTTTTACAATAATGAAATTGGAAATTATAACTAT
GGTAAGCTGCATTTGATGAATCCTAAGAGAATTTCTATGACTCACTCTTTGATTGTTGGA
TACGGAGTTTACAAAGATCTTGATGTTTATACCACAAGAGAAGCAACAAAAGAAGAAATT
ATGCAATTTCATGATTAAGATTATGTTGAATACCTCTCTAACTATGTTTCAAGCTCTAAG
ATAGATTTTCTGAAGAAAAATGGATGCAGTATACCTTTAATAGATGAAGATGCAAAAAAT
GATAGTGATAAAAAGAAGTAATATGGTATTGATGTATAAGCGGACTGCCCAGGTTTTGAT
GGACTCTATACTTTTAGTCAGCTCTCAACAGGTGGCTCTATCGATGCGGCTCATTTGATC
ATAAATAATGCAGCTGATATTGCTATTAACTGGGGAGGAGGTTTGCATCATGCGAAAAAA
GGAGAAGCATATGGATTTTGCTATGTAAACGATATAGTTATATGTATTCTTGAACTTTTA
AAAGTCTTTCCACGTGTTTTATATATTGATATCGATGTTCACCATGGTGATGGTGTTGAA
GAAGCTTTCTATACAACTAACCGTGTAATGACTGTAAGTTTTCATGAGTTTGGTGAGGAT
TTCTTCCCAGGGACAGGAGGATTAAATAGCAATGGAGAAGGTTTAGGTAAAAACTATGCA
GTGAATGTACCTTTGAGACCTGGTATGGATGACGAAAGTTATGTTTAATTATTTAAAAAT
GTCATGAACAAAGTTATGGAAGTATATAGACCTGATGTTGTAGTATTTTAAACAGGAGCT
GATAGCTTAGCAAATGATAAAATAGGTCATTTTAACCTTTCTATAAAAGGTCATGGATAG
TGCTTAACATATATGATGGGCTTTAATGTACCTCTTGTAGTATTAGGAGGAGGTGGATAC
ACTATTTAAAATGTTAGTCGTTGTTGGGCATTTGAAACAGGACTGTTAGTTAAAAAAAGT
CTTAATGGTCCCATACCTGTTGATGACCCTTTCTTCCATTTATACGAAAAATAGAATGTG
TTGCATGTCCCTATATAGTAAGTAGAAAATAAAAATAGTAAAGAAGACTTAAATAAAATT
TAAGAAGAAATATTCAAACAGCTTAAAGATGTTGAAGCTGCTCCTGGAGTTCCCTTCCAC
ACAGTTCCTCGCACATTTTTGTATGATGATGAGGAATACTTTGATGAGCATGAAATGGAT
AAAAATCATGATTATGATGGAAATAACTATGATTAAGATAAGCTCAACGATTATATTAAT
GGCTACCACTAAATGGATATTGAGTAAAATGATTAGAATGAAATAATTAGAAAGTCACCA
CTGCTCATTGAAAAAAGAAATAAATTTAATCATATTTGA


>TTHERM_00663829(gene)
ATGGAGACTAAAAAAAAAGTAGCATATTTTTACAATAATGAAATTGGAAATTATAACTAT
GGTAAGCTGCATTTGATGAATCCTAAGAGAATTTCTATGACTCACTCTTTGATTGTTGGA
TACGGAGTTTACAAAGATCTTGATGTTTATACCACAAGAGAAGCAACAAAAGAAGAAATT
ATGCAATTTCATGATTAAGATTATGTTGAATACCTCTCTAACTATGTTTCAAGCTCTAAG
ATAGATTTTCTGAAGAAAAATGGATGCAGTATACCTTTAATAGATGAAGATGCAAAAAAT
GATAGTGATAAAAAGAAGTAATATGGTATTGATGTATAAGCGGACTGCCCAGGTTTTGAT
GGACTCTATACTTTTAGTCAGCTCTCAACAGGTGGTTACTCAATAATTTATTTTTAATTT
TTTTTATTAAATACTCTAGGAAATAAAATGTATTATTAAATAATATTCACAATATTTTGG
ATCATCAAGCTATTTAAGCTTTTTTTTCTCTACTTTTTCTTTGATTGTTTAGAAGAATAT
AAGCAGCCTACTTTAATAATAATTTAGTTATATATTAATATTAATAGAGATTGGTTTTAA
ATCATAGATATATATACTAAATTATGATGATTAATTTTTTTAAGTATTTAAGTTAAAGTT
ATATATTTAAAATAAGGTGGCTCTATCGATGCGGCTCATTTGATCATAAATAATGCAGCT
GATATTGCTATTAACTGGGGAGGAGGTTTGCATCATGCGAAAAAAGGAGAAGCATATGGA
TTTTGCTATGTAAACGATATAGTTATATGTATTCTTGAACTTTTAAAAGTCTTTCCACGT
GTTTTATATATTGATATCGATGTTCACCATGGTGATGGTGTTGAAGAAGCTTTCTATACA
ACTAACCGTGTAATGACTGTAAGTTTTCATGAGTTTGGTGAGGATTTCTTCCCAGGGACA
GGAGGATTAAATAGCAATGGAGAAGGTTTAGGTAAAAACTATGCAGTGAATGTACCTTTG
AGACCTGGTATGGATGACGAAAGTTATGTTTAATTATTTAAAAATGTCATGAACAAAGTT
ATGGAAGTATATAGACCTGATGTTGTAGTATTTTAAACAGGAGCTGATAGCTTAGCAAAT
GATAAAATAGGTCATTTTAACCTTTCTATAAAAGGTCATGGATAGTGCTTAACATATATG
ATGGGCTTTAATGTACCTCTTGTAGTATTAGGAGGAGGTGGATACACTATTTAAAATGTT
AGTCGTTGTTGGGCATTTGAAACAGGACTGTTAGTTAAAAAAAGTCTTAATGGTCCCATA
CCTGTTGATGACCCTTTCTTCCATTTATACGAAAAATAGAATGTGTTGCATGTCCCTATA
TAGTAAGTAGAAAATAAAAATAGTAAAGAAGACTTAAATAAAATTTAAGAAGAAATATTC
AAACAGCTTAAAGATGTTGAAGCTGCTCCTGGAGTTCCCTTCCACACAGTTCCTCGCACA
TTTTTGTATGATGATGAGGAATACTTTGATGAGCATGAAATGGATAAAAATCATGATTAT
GATGGAAATAACTATGATTAAGATAAGCTCAACGATTATATTAATGGCTACCACTAAATG
GATATTGAGTAAAATGATTAGAATGAAATAATTAGAAAGTCACCACTGCTCATTGAAAAA
AGAAATAAATTTAATCATATTTGA