Identifiers and Description

Gene Model Identifier

TTHERM_00661650

Standard Name

GST34 (Glutathione S-transferase mu 34, TtGSTm34, GSTm34)

Aliases

PreTt23810 | 98.m00153 | 3736.m00053

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17214.16.0022633569573e-125glutathione S-transferase ...
OxytrichaContig16299.0.g153.00033207980219e-32Glutathione S-transferase, N-t
erminal domain
ParameciumDBGSPATP000285560018.00148640344055e-25Paramecium tetraurelia GSPATP0
0028556001 protein
ParameciumDBGSPATP000336720018.00148640344055e-25Paramecium tetraurelia GSPATP0
0033672001 protein
IPI(HUMAN)IPI:IPI00419235.37.99680615912654e-24 PROT:P46439|TREMBL:Q5T8R2|ENS
EMBL:ENSP00000256593|REFSEQ :N
P_000842|VEGA:OTTHUMP000000133
59 Tax_Id=9606 Glutathione S-t
ransferase Mu 5
PlasmoDBPF14_01873.00093967604081e-05Plasmodium falciparum 0187
DictyBaseDDB02314320.00029991843608222geneDDB0231432
DictyBaseDDB02174530.00029991843608222JC2V2_0_01492 Similar to Xenop
us laevis (African clawed frog
). glutathione s-transferase.
DictyBaseDDB01679470.00029991843608222geneDDB0231432 putative glutat
hione S-transferase putative g
lutathione transferase putativ
e glutathione S-transferase pu
tative glutathione transferase
WormBaseR107.70.00199921635041117WBGene00001749 gst-1 glutathio
ne S-transferase

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00661650(coding)
ATGACAACTCTTGGTTACTGGGGCATCAGAGGTTTGGCTCAACCTATCCGTTTCTTACTT
GCCTACTTAGGTGTCTAATACACTAATAAGGCCTACGCCAATCCTGAAGAATGGTTCGGA
AAGGATAAGAATGAACTCGGCTTTGACTTCCCCAACATTCCCTACTTAATTGATGGTGAT
CTTAAACTTACTGAATCTTCTGCTATTCCTATTTATCTTATCAGAAAGCACAAAAGAAAC
GAGTTGTTAGGATCTTCTGCTGACGGTTCTTACAGTGAAAAGGAAGTTAGAGTCGCTTAA
ATTGTTGGTGTTATTAGAGATCTTTTTAAGGAACTCACAGGCTTATGTTTCAACCCTGAC
TTCAAAAACATTAAAGAAAAGCTCTACACTGAAAAGCTCGAACTCTTAATTAAGAGACTC
GGTGCTTATCTTGGTGATAAGGAATTCATAGTTGGTACCTTGACTTATGCTGATTTTCTT
TTCTATGAAGCCCTCAGCTATATTAGACATATTTATCCCCAAGCCATTTGTGCTACTCTT
ACTGCTTATATCAACAGATTTGAAAACCTCCCTGGTATTAAGGAATACATTGCTAGCCAT
GCCTAAGAACTTAAGGTTTTCTTACCTCCTCAAAGAGCTACCTGGTCTGGTCCTTAATGA



>TTHERM_00661650(protein)
MTTLGYWGIRGLAQPIRFLLAYLGVQYTNKAYANPEEWFGKDKNELGFDFPNIPYLIDGD
LKLTESSAIPIYLIRKHKRNELLGSSADGSYSEKEVRVAQIVGVIRDLFKELTGLCFNPD
FKNIKEKLYTEKLELLIKRLGAYLGDKEFIVGTLTYADFLFYEALSYIRHIYPQAICATL
TAYINRFENLPGIKEYIASHAQELKVFLPPQRATWSGPQ


>TTHERM_00661650(gene)
ATAAAACATCTCTAAGAAATTTAATTCAATATAAATAAATGACAACTCTTGGTTACTGGG
GCATCAGAGGTTTGGCTCAACCTATCCGTTTCTTACTTGCCTACTTAGGTGTCTAATACA
CTAATAAGGCCTACGCCAATCCTGAAGAATGGTTCGGAAAGGATAAGAATGAACTCGGCT
TTGACTTCCCCAACATTCCCTACTTAATTGATGGTGATCTTAAACTTACTGAATCTTCTG
CTATTCCTATTTATCTTATCAGAAAGCACAAAAGAAACGAGTTGTTAGGATCTTCTGCTG
ACGGTTCTTACAGTGAAAAGGAAGTTAGAGTCGCTTAAATTGTTGGTGTTATTAGAGATC
TTTTTAAGGAACTCACAGGCTTATGTTTCAACCCTGACTTCAAAAACATTAAAGAAAAGC
TCTACACTGAAAAGCTCGAACTCTTAATTAAGAGACTCGGTGCTTATCTTGGTGATAAGG
AATTCATAGTTGGTACCTTGACTTATGCTGATTTTCTTTTCTATGAAGCCCTCAGCTATA
TTAGACATATTTATCCCCAAGCCATTTGTGCTACTCTTACTGCTTATATCAACAGATTTG
AAAACCTCCCTGGTATTAAGGAATACATTGCTAGCCATGCCTAAGAACTTAAGGTTTTCT
TACCTCCTCAAAGAGCTACCTGGTCTGGTCCTTAATGATTTAATTTAAATAAGAACATTA
AATTTATTCTAAGTATTTTTTATATTTTCATATCTATCTTGCAAAAGAA