Identifiers and Description

Gene Model Identifier

TTHERM_00655520

Standard Name

None

Aliases

PreTt03650 | 96.m00119

Description

Copper/zinc superoxide dismutase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00080 ) copper/zinc superoxide dismutase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
ParameciumDBGSPATP000134290016.00035495573741e-39Paramecium tetraurelia GSPATP0
0013429001 protein
WormBaseC15F1.7a9.00008060829861e-38WBGene00004930 sod-1 superoxid
e dismutase
DictyBaseDDB01893723.000842737734e-34sodA superoxide dismutase
DictyBaseDDB01912903.000842737734e-34sodA superoxide dismutase
IPI(HUMAN)IPI:IPI00218733.56.00080220904052e-34 PROT:P00441|TREMBL:Q6NR85|ENS
EMBL:ENSP00000270142|REFSEQ :N
P_000445|H-INV:HIT000030086 Ta
x_Id=9606 Superoxide dismutase
FlyBaseFBgn00034623.99937413575047e-31
TAIRAT1G088302.99982150876985e-30superoxide dismutase (Cu-Zn) (
SODCC) / copper/zinc superoxid
e dismutase (CSD1)
SGDYJR104C1.99964106474725e-29SOD1 SGDID:S000003865, Chr X f
rom 622928-622464, reverse com
plement, Verified ORF, "Cu, Zn
superoxide dismutase; some mu
tations are analogous to those
that cause ALS (amyotrophic l
ateral sclerosis) in humans"

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00655520(coding)
ATGGCTCAACACGCTCCCGTATACGCTATCTGCTTATTGAAGAACGAAACTAACACCGTC
TCTGCTGTTGTTAGATTAGTTGAAAAGTTCGAAAACAACAAATTCGTCACTCACCTTAAG
GCTACTTTCAAGGGTTTACCTGCTGGTCTTCATGGTTTCCATGTTCATCAATATGGTGAT
TTGTCTAACGGCTGTGCTACTGCAGGTCCTCACTTCAATCCCTTCAACAAATAACACGGT
GGCCCAAATGACGAAAACAGACACGTTGGTGATCTTGGTAACGTTACCGCTGTTGATGGT
CAAGATACTAACTTCGAATTCTAGAGCGATTTAATCAGATTATCTGGTGAAAACACTATT
GTTGGAAGATCTTTCGTCATCCACGCTGATGAAGATGACTTAGGAAAGGGTAACTTTGAA
GATTCCAAGACTACTGGTCATGCTGGTGCTAGACTTGCTTGCGGTATCATCGCCCTCGCT
GCTCCCTTCGAAAATTTCTGA


>TTHERM_00655520(protein)
MAQHAPVYAICLLKNETNTVSAVVRLVEKFENNKFVTHLKATFKGLPAGLHGFHVHQYGD
LSNGCATAGPHFNPFNKQHGGPNDENRHVGDLGNVTAVDGQDTNFEFQSDLIRLSGENTI
VGRSFVIHADEDDLGKGNFEDSKTTGHAGARLACGIIALAAPFENF


>TTHERM_00655520(gene)
AAAAAAAAAATTAAAAAAATTTATCAAAAATTCAGCGTTTAAATTAAATAAATTAGCACA
TTCCTCAAATGGCTCAACACGCTCCCGTATACGCTATCTGCTTATTGAAGAACGAAACTA
ACACCGTCTCTGCTGTTGTTAGATTAGTTGAAAAGTTCGAAAACAACAAATTCGTCACTC
ACCTTAAGGCTACTTTCAAGGGTTTACCTGCTGGTCTTCATGGTTTCCATGTTCATCAAT
ATGGTGATTTGTCTAACGGCTGTGCTACTGCAGGTAATTATAATTGAATTAAACCAATAC
TTAATCATCTAATGAACTCATCAATATAAGCAGAAAATAATAATAACTCATAAATCAACT
AACTACATTCTTTCAAAAACTTTATTAAGCATAAATAAATATTTTTGTTTTAGAAGCTTT
TCTTACAATGACCTTAAAGTTGAATTAAATAATTCGGCAGCAAGATTATTTTAAGTAAAT
AACAAGGATTATATAGGATTGAATACTTTTATTCATTTCTAATCAAGCTTTTAATAGAAT
TCTTTTATTCAAAAATTGTTTTTTTCATTTATAATTAAAATTATTCATGTAAAAAAAATA
GGTCCTCACTTCAATCCCTTCAACAAATAACACGGTGGCCCAAATGACGAAAACAGACAC
GTTGGTGATCTTGGTAACGTTACCGCTGTTGATGGTCAAGATACTAACTTCGAATTCTAG
AGCGATTTAATCAGATTATCTGGTGAAAACACTATTGTTGGAAGATCTTTCGTCATCCAC
GCTGATGAAGATGACTTAGGAAAGGGTAACTTTGAAGATTCCAAGACTACTGGTCATGCT
GGTGCTAGACTTGCTTGCGGTATCATCGCCCTCGCTGCTCCCTTCGAAAATTTCTGAAAT
CAAATTAAAGAAATATAAAAAATAAAATAAATATATT