Identifiers and Description

Gene Model Identifier

TTHERM_00655520

Standard Name

None

Aliases

PreTt03650 | 96.m00119

Description

Copper/zinc superoxide dismutase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00080 ) copper/zinc superoxide dismutase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18001.17.001811683013561e-96copper/zinc superoxide dismuta
se (170 aa)
WormBaseWBGene000049301.9997255150861791e-53locus:sod-1 Superoxide dismu
tase [Cu-Zn] status:Confirme
d UniProt:P34697 protein_i
d:CCD64617.1
DictyBaseDDB_G02674203.00017180903994e-49sodA on chromosome: 1 position
338107 to 338878
OxytrichaContig15813.0.g1051.0000844672813518e-48Copper/zinc superoxide dismuta
se (SODC)
SGDYJR104C3.999458587140588e-43SOD1 Cytosolic copper-zinc sup
eroxide dismutase; some mutati
ons are analogous to those tha
t cause ALS (amyotrophic later
al sclerosis) in humans

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00655520(coding)
ATGGCTCAACACGCTCCCGTATACGCTATCTGCTTATTGAAGAACGAAACTAACACCGTC
TCTGCTGTTGTTAGATTAGTTGAAAAGTTCGAAAACAACAAATTCGTCACTCACCTTAAG
GCTACTTTCAAGGGTTTACCTGCTGGTCTTCATGGTTTCCATGTTCATCAATATGGTGAT
TTGTCTAACGGCTGTGCTACTGCAGGTCCTCACTTCAATCCCTTCAACAAATAACACGGT
GGCCCAAATGACGAAAACAGACACGTTGGTGATCTTGGTAACGTTACCGCTGTTGATGGT
CAAGATACTAACTTCGAATTCTAGAGCGATTTAATCAGATTATCTGGTGAAAACACTATT
GTTGGAAGATCTTTCGTCATCCACGCTGATGAAGATGACTTAGGAAAGGGTAACTTTGAA
GATTCCAAGACTACTGGTCATGCTGGTGCTAGACTTGCTTGCGGTATCATCGCCCTCGCT
GCTCCCTTCGAAAATTTCTGA


>TTHERM_00655520(protein)
MAQHAPVYAICLLKNETNTVSAVVRLVEKFENNKFVTHLKATFKGLPAGLHGFHVHQYGD
LSNGCATAGPHFNPFNKQHGGPNDENRHVGDLGNVTAVDGQDTNFEFQSDLIRLSGENTI
VGRSFVIHADEDDLGKGNFEDSKTTGHAGARLACGIIALAAPFENF


>TTHERM_00655520(gene)
ATGGCTCAACACGCTCCCGTATACGCTATCTGCTTATTGAAGAACGAAACTAACACCGTC
TCTGCTGTTGTTAGATTAGTTGAAAAGTTCGAAAACAACAAATTCGTCACTCACCTTAAG
GCTACTTTCAAGGGTTTACCTGCTGGTCTTCATGGTTTCCATGTTCATCAATATGGTGAT
TTGTCTAACGGCTGTGCTACTGCAGGTAATTATAATTGAATTAAACCAATACTTAATCAT
CTAATGAACTCATCAATATAAGCAGAAAATAATAATAACTCATAAATCAACTAACTACAT
TCTTTCAAAAACTTTATTAAGCATAAATAAATATTTTTGTTTTAGAAGCTTTTCTTACAA
TGACCTTAAAGTTGAATTAAATAATTCGGCAGCAAGATTATTTTAAGTAAATAACAAGGA
TTATATAGGATTGAATACTTTTATTCATTTCTAATCAAGCTTTTAATAGAATTCTTTTAT
TCAAAAATTGTTTTTTTCATTTATAATTAAAATTATTCATGTAAAAAAAATAGGTCCTCA
CTTCAATCCCTTCAACAAATAACACGGTGGCCCAAATGACGAAAACAGACACGTTGGTGA
TCTTGGTAACGTTACCGCTGTTGATGGTCAAGATACTAACTTCGAATTCTAGAGCGATTT
AATCAGATTATCTGGTGAAAACACTATTGTTGGAAGATCTTTCGTCATCCACGCTGATGA
AGATGACTTAGGAAAGGGTAACTTTGAAGATTCCAAGACTACTGGTCATGCTGGTGCTAG
ACTTGCTTGCGGTATCATCGCCCTCGCTGCTCCCTTCGAAAATTTCTGA