Identifiers and Description

Gene Model Identifier

TTHERM_00653910

Standard Name

LIA5 (localized in macronuclear anlagen 5)

Aliases

PreTt12878 | 95.m00124 | 3825.m02531

Description

zinc finger protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00653910

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00713.19.997093137033517e-262hypothetical protein (905 aa)

General Information

Paragraph NoGene NameParagraph Text
115COI6,
JMJ1,
LIA5,
COI7
Coi6p, its interaction partners Coi7p and Lia5p, and the histone demethylase Jmj1p are crucial for confining the production of small RNAs and the formation of heterochromatin to the eliminated sequences. The loss of Coi6p, Coi7p or Jmj1p causes ectopic DNA elimination.

Associated Literature

  1. Ref:29021213: Noto T, Mochizuki K (2017) Whats, hows and whys of programmed DNA elimination in Tetrahymena. Open biology 7(10):
  2. Ref:28273462: Suhren JH, Noto T, Kataoka K, Gao S, Liu Y, Mochizuki K (2017) Negative Regulators of an RNAi-Heterochromatin Positive Feedback Loop Safeguard Somatic Genome Integrity in Tetrahymena. Cell reports 18(10):2494-2507
  3. Ref:28087716: Cheng CY, Young JM, Lin CG, Chao JL, Malik HS, Yao MC (2016) The piggyBac transposon-derived genes TPB1 and TPB6 mediate essential transposon-like excision during the developmental rearrangement of key genes in Tetrahymena thermophila. Genes & development 30(24):2724-2736
  4. Ref:24069402: Shieh AW, Chalker DL (2013) LIA5 is required for nuclear reorganization and programmed DNA rearrangements occurring during tetrahymena macronuclear differentiation. PloS one 8(9):e75337
  5. Ref:17519286: Yao MC, Yao CH, Halasz LM, Fuller P, Rexer CH, Wang SH, Jain R, Coyne RS, Chalker DL (2007) Identification of novel chromatin-associated proteins involved in programmed genome rearrangements in Tetrahymena. Journal of cell science 120(Pt 12):1978-89

Sequences

>TTHERM_00653910(coding)
ATGGAATTAGGAGAAGCAGATTTACATACATCACAATCAATAGTTTAGGAAGAAGTTCCT
ATGCAACAAGAGGTTAATATTCAAGAAGAATAAAATTCTTAATTTGACAATGTTTAATAA
CAAAATCAGAATGTAGAAGAATAACATTAAACAAATAAAAATAATTTAACTTAAAATGAT
TTTAATGAATTTCAATAATAAAATACAAATGAGCAAGACTTACCAAGAAACGATCAAACA
TAGGTTTAACCTCAATAAAACTTGTAGGATGAAAATAATTAAGACTAAACTATACATTTT
ACAGAGTAGCACTTTCAACAACGAGAAAGGGAATCTAGTGAAACTCATGATACAAGCAAT
TAAGAATTAGAATATTAAATTAATTAAAATATAAATGAAAATAAATAAGTACAAAAAGAT
AACTTAAATGAAGAAATTATATCTTAAAATAAAGAAGCACTTGATGGACAAGAAGATTAT
CAGAATTTCAATAAAAAAGATTTACCTGATAATAATAATAGTAATGAATAACATAACTAA
GATTAAGAAAATATGAATTAAATTGAAAGTTAAGAAGGTTAAAATTAATTAGTTTAGATA
GAAGTCAATGGTTCAGTGAATAGCCTATAAGAAAATAACTACATCTAAGATGGCACGTTT
ATGGAGTAAGAACATTTAAATGATAAAATGCAATAATAATAGGAATAGGCTGTAAAAGAA
GAAACTGAAGAAAGAGAAGAAATGTAAGAGGAGAATTAACTCCATGAAAATTAAGAAAAT
ATTAGTATCAGCTAATAAAATTAGTAAGCTCACAGTGATATGTAAATCGAAGTGTAAGCA
AATTAAATTAATTAATAAGAGAACCAGTTAGAATCTTTAAATGACAAGGAAGTTGTTAAA
GAAGAAAATAATTTGCTTTTAAATATACTTTCTGATGAAAATAATAAAAGATTTCAAAGA
CTTCCACCAGAATTGTCTCCCAATATTTTTTGTCATTTTTTGGGAGGCAAATCATTACAA
TTGACTAACATCAATGATTCTAGCAGGCTTTTTATGTATTTCTTGGGAACTAAGATATTA
AGATAGCTGCTTAATAAAGCAAATGTAAAGCTAAGAGAAATTTACAAGAAATAAAATGAC
GTTAAGGAATATACTATTGAAGAAATACAAGTCTATTAAGCTTTGAAAATTTTGATGGGT
TTACAATAAAACTCAAGCAATTTTGACTTTTTCCTTCTAAAAGATCTTCAAAAAATTCCT
CCATATCACCAACTCTTTACAAACGAAAGATTTTAATTCCTTCTTGATTGCGAAAGAGAG
TTAAATAAAGACATTTTAAATAATGAATAACTTATTTAAGACTTTGTTTAGAGAGCTTAA
AATTCCTAGACTTCTGATTAAGAATTGGTTTTAATATCAAAAAAAGGAAAAGTTGGTGAA
GAAATTATTCACAATAATTCTGTTTATACATAGATATTCTTATGTGAGTTGAGTTCAGCC
TTTGTTTTTGGCTACTTTGTTGTCAAAGATATGAGTTCTTTTGCAAATTAAATTTGTATA
AATTTAGAGAGTTTTACTAATCAAAACCATCATGTATATTTTTAGAACGAAGAATTTTTT
TCTAATTATGAAAAAATTTAAGAACTTTTGAATAGCAAAATACACATAAGTTCTTTTTTA
AATAACAAATTTGACTAATTTCCATAATCTCTTTAAAATGAAATGCTCCACAATAAACCA
TTAAAAGCAAATAACAGTGAGACTATATTTGATAGGCAGACTTAAACTTAGCTTCTTATT
AAATCGGATGAAAATTTAAAGAAAGAAGTCTTTTTAACTACCAGTGGTACAGTTAAATAA
GATAAAATGGTTGAAAAGCATAAGCAAGCAATTTAAAAAATAACTTAAAAGCTTAGAATG
CTACTAACAGAATACAGGTTTGTAAGTATCAATAATGATACGACATCTATCTTTGAAGAG
TTATCCGAGATAGCGATTTAAAACTCTTATATAATTTATTCCCAAGCAAAAGAAAAAATG
GATTACAGACTATTTAGATTTAAATTAGCATAAGATTTACTCTAAAAATAAATACAAAAG
ATAAAATAAGAGGAATTATAAAATGTTAAATCTAAACTAATTGATGTTGAAGTTTAAACA
GATAAAGTTGTTGAAAGTGTAATAAATGTTGAAACTCACGCTCTTTCTAAATCTCCAAAA
TCATCAGATAATAATGAATAGTTCATAATGAATGAAGTTAATTCACCTGTCTTTTAGGGA
AATGATTAAAATATCAGACAAGGAGGTACTCATGTCTAGAAAAAAGATGGTAAGTAAGGT
ATTTGCTTAGTTTGCTTACAAGAAAAAAATATTTAAAATAATACATTCATAACATGCTAA
GAATGCTCTTTACAAAATAAAAAGCCAGTTTATTTATGTGACAAGTGCTTTGAAGTATAT
CATTTAGAGATAAATGTTAACAGAGACAACTTTGATAAAAAAAATTTCTCTAGGCTAAGC
ACCCTAAAAAATTCAGTTACAACAGTTCCAATAGATAAAATGGCACCTAAGCCATTATAA
AATGGATATGGAAGTAATGGACTCAATGGAGGTTACAATACGGTTAATCCTCCTATTTAG
TAACCTTTAATGAACAATGGGTACAATGGATATTAACCATAATAAACTTAAGTGAGGAGA
AGAAGAACAGCTAATATTTAAGATGGGTATGAAACTTCAGGCCCTGCCTTTAACTCAATG
GTACCACCTCAAATGAATGGAAATATGATGGGATAATAAATTCCTTTAAAAAGAAGAGGA
CCTGCTTTGGATGACTCTGGATTTAGAAGTGATGCCCCTTCAAGCTATATTCCTGCTACA
AGAGGCAGAAAGAAATTAAATCATGGCTAAGACTAATTACCACCTAGAAATCAATATGGT
TACTCTGATTTAGGATAGCCAAACAACATGAATGGATATGGATAAGGGATGGGAAATAAT
GCAACAAATGGATATGATAGATACTCAAGAGGAGTTGACATGAATGGATATACTACTTCA
GATCCTGCATATGGCAGAAATTATCAAGGGGCAGATAATTACAATAATAATTAAATATAT
AGAGGTGTAGGTACTCAAAGAAAGTGA


>TTHERM_00653910(protein)
MELGEADLHTSQSIVQEEVPMQQEVNIQEEQNSQFDNVQQQNQNVEEQHQTNKNNLTQND
FNEFQQQNTNEQDLPRNDQTQVQPQQNLQDENNQDQTIHFTEQHFQQRERESSETHDTSN
QELEYQINQNINENKQVQKDNLNEEIISQNKEALDGQEDYQNFNKKDLPDNNNSNEQHNQ
DQENMNQIESQEGQNQLVQIEVNGSVNSLQENNYIQDGTFMEQEHLNDKMQQQQEQAVKE
ETEEREEMQEENQLHENQENISISQQNQQAHSDMQIEVQANQINQQENQLESLNDKEVVK
EENNLLLNILSDENNKRFQRLPPELSPNIFCHFLGGKSLQLTNINDSSRLFMYFLGTKIL
RQLLNKANVKLREIYKKQNDVKEYTIEEIQVYQALKILMGLQQNSSNFDFFLLKDLQKIP
PYHQLFTNERFQFLLDCERELNKDILNNEQLIQDFVQRAQNSQTSDQELVLISKKGKVGE
EIIHNNSVYTQIFLCELSSAFVFGYFVVKDMSSFANQICINLESFTNQNHHVYFQNEEFF
SNYEKIQELLNSKIHISSFLNNKFDQFPQSLQNEMLHNKPLKANNSETIFDRQTQTQLLI
KSDENLKKEVFLTTSGTVKQDKMVEKHKQAIQKITQKLRMLLTEYRFVSINNDTTSIFEE
LSEIAIQNSYIIYSQAKEKMDYRLFRFKLAQDLLQKQIQKIKQEELQNVKSKLIDVEVQT
DKVVESVINVETHALSKSPKSSDNNEQFIMNEVNSPVFQGNDQNIRQGGTHVQKKDGKQG
ICLVCLQEKNIQNNTFITCQECSLQNKKPVYLCDKCFEVYHLEINVNRDNFDKKNFSRLS
TLKNSVTTVPIDKMAPKPLQNGYGSNGLNGGYNTVNPPIQQPLMNNGYNGYQPQQTQVRR
RRTANIQDGYETSGPAFNSMVPPQMNGNMMGQQIPLKRRGPALDDSGFRSDAPSSYIPAT
RGRKKLNHGQDQLPPRNQYGYSDLGQPNNMNGYGQGMGNNATNGYDRYSRGVDMNGYTTS
DPAYGRNYQGADNYNNNQIYRGVGTQRK


>TTHERM_00653910(gene)
ATGGAATTAGGAGAAGCAGATTTACATACATCACAATCAATAGTTTAGGAAGAAGTTCCT
ATGCAACAAGAGGTTAATATTCAAGAAGAATAAAATTCTTAATTTGACAATGTTTAATAA
CAAAATCAGAATGTAGAAGAATAACATTAAACAAATAAAAATAATTTAACTTAAAATGAT
TTTAATGAATTTCAATAATAAAATACAAATGAGCAAGACTTACCAAGAAACGATCAAACA
TAGGTTTAACCTCAATAAAACTTGTAGGATGAAAATAATTAAGACTAAACTATACATTTT
ACAGAGTAGCACTTTCAACAACGAGAAAGGGAATCTAGTGAAACTCATGATACAAGCAAT
TAAGAATTAGAATATTAAATTAATTAAAATATAAATGAAAATAAATAAGTACAAAAAGAT
AACTTAAATGAAGAAATTATATCTTAAAATAAAGAAGCACTTGATGGACAAGAAGATTAT
CAGAATTTCAATAAAAAAGATTTACCTGATAATAATAATAGTAATGAATAACATAACTAA
GATTAAGAAAATATGAATTAAATTGAAAGTTAAGAAGGTTAAAATTAATTAGTTTAGATA
GAAGTCAATGGTTCAGTGAATAGCCTATAAGAAAATAACTACATCTAAGATGGCACGTTT
ATGGAGTAAGAACATTTAAATGATAAAATGCAATAATAATAGGAATAGGCTGTAAAAGAA
GAAACTGAAGAAAGAGAAGAAATGTAAGAGGAGAATTAACTCCATGAAAATTAAGTATTC
TTTAATTTTACTTATATTATTTTTAACTTAAACTTAAATTTTTAAGGAAAATATTAGTAT
CAGCTAATAAAATTAGTAAGCTCACAGTGATATGTAAATCGAAGTGTAAGCAAATTAAAT
TAATTAATAAGAGAACCAGTTAGAATCTTTAAATGACAAGGAAGTTGTTAAAGAAGAAAA
TAATTTGCTTTTAAATATACTTTCTGATGAAAATAATAAAAGATTTCAAAGACTTCCACC
AGAATTGTCTCCCAATATTTTTTGTCATTTTTTGGGAGGCAAATCATTACAATTGACTAA
CATCAATGATTCTAGCAGGCTTTTTATGTATTTCTTGGGAACTAAGATATTAAGATAGCT
GCTTAATAAAGCAAATGTAAAGCTAAGAGAAATTTACAAGAAATAAAATGACGTTAAGGA
ATATACTATTGAAGAAATACAAGTCTATTAAGCTTTGAAAATTTTGATGGGTTTACAATA
AAACTCAAGCAATTTTGACTTTTTCCTTCTAAAAGATCTTCAAAAAATTCCTCCATATCA
CCAACTCTTTACAAACGAAAGGTGGCTAATTTACAATTTTACAATTTTATATTTAAAATA
TTTTAATGTTTTAAAAATAGATTTTAATTCCTTCTTGATTGCGAAAGAGAGTTAAATAAA
GACATTTTAAATAATGAATAACTTATTTAAGACTTTGTTTAGAGAGCTTAAAATTCCTAG
ACTTCTGATTAAGAATTGGTTTTAATATCAAAAAAAGGAAAAGTTGGTGAAGAAATTATT
CACAATAATTCTGTTTATACATAGATATTCTTATGTGAGTTGAGTTCAGCCTTTGTTTTT
GGCTACTTTGTTGTCAAAGATATGAGTTCTTTTGCAAATTAAATTTGTATAAATTTAGAG
AGTTTTACTAATCAAAACCATCATGTATATTTTTAGAACGAAGAATTTTTTTCTAATTAT
GAAAAAATTTAAGAACTTTTGAATAGCAAAATACACATAAGTTCTTTTTTAAATAACAAA
TTTGACTAATTTCCATAATCTCTTTAAAATGAAATGCTCCACAATAAACCATTAAAAGCA
AATAACAGTGAGACTATATTTGATAGGCAGACTTAAACTTAGCTTCTTATTAAATCGGAT
GAAAATTTAAAGAAAGAAGTCTTTTTAACTACCAGTGGTACAGTTAAATAAGATAAAATG
GTTGAAAAGCATAAGCAAGCAATTTAAAAAATAACTTAAAAGCTTAGAATGCTACTAACA
GAATACAGGTTTGTAAGTATCAATAATGATACGACATCTATCTTTGAAGAGTTATCCGAG
ATAGCGATTTAAAACTCTTATATAATTTATTCCCAAGCAAAAGGTAAATAAAATGATAAA
AAATTTAATAACCATAATCTTTTTTATTTAAAAAATTTTTTTAAAATATTTAAATAGAAA
AAATGGATTACAGACTATTTAGATTTAAATTAGCATAAGATTTACTCTAAAAATAAATAC
AAAAGATAAAATAAGAGGAATTATAAAATGTTAAATCTAAACTAATTGATGTTGAAGTTT
AAACAGATAAAGTTGTTGAAAGTGTAATAAATGTTGAAACTCACGCTCTTTCTAAATCTC
CAAAATCATCAGATAATAATGAATAGTTCATAATGAATGAAGTTAATTCACCTGTCTTTT
AGGGAAATGATTAAGTAAAATTTTAAGAAAATAAACGAACATCTTATTAAATAATTATAA
TTTTTAGAATATCAGACAAGGAGGTACTCATGTCTAGAAAAAAGATGGTAAGTAAGGTAT
TTGCTTAGTTTGCTTACAAGAAAAAAATATTTAAAATAATACATTCATAACATGCTAAGA
ATGCTCTTTACAAAATAAAAAGCCAGTTTATTTATGTGACAAGTGCTTTGAAGTATATCA
TTTAGAGATGTATGATAAATATCAAATTTATTTTAATAGATTTTTATTTATTTTATTTTT
TGAAATAGAAATGTTAACAGAGACAACTTTGATAAAAAAAATTTCTCTAGGCTAAGCACC
CTAAAAAATTCAGTTACAACAGTTGTAATACAAACTTAATCATCCTTTCAAAATGAATAT
TTATGTATATTTTTAATCTAAAAAGCCAATAGATAAAATGGCACCTAAGCCATTATAAAA
TGGATATGGAAGTAATGGACTCAATGGAGGTTACAATACGGTTAATCCTCCTATTTAGTA
ACCTTTAATGAACAATGGGTACAATGGATATTAACCATAATAAACTTAAGTGAGGAGAAG
AAGAACAGCTAATATTTAAGATGGGTATGAAACTTCAGGCCCTGCCTTTAACTCAATGGT
ACCACCTCAAATGAATGGAAATATGATGGGATAATAAATTCCTTTAAAAAGAAGAGGACC
TGCTTTGGATGACTCTGGATTTAGAAGTGATGCCCCTTCGTAATTTTTCTTAGATATTTA
TAAATTTATCAAATAATTATTTTTTATAAACAGAAGCTATATTCCTGCTACAAGAGGCAG
AAAGAAATTAAATCATGGCTAAGACTAATTACCACCTAGAAATCAATATGGTTACTCTGA
TTTAGGATAGCCAAACAACATGAATGGATATGGATAAGGGATGGGAAATAATGCAACAAA
TGGATATGATAGATACTCAAGAGGAGTTGACATGAATGGATATACTACTTCAGATCCTGC
ATATGGCAGAAATTATCAAGGGGCAGATAATTACAATAATAATTAAATATATAGAGGTGT
AGGTACTCAAAGAAAGTGA