Identifiers and Description

Gene Model Identifier

TTHERM_00641240

Standard Name

GPM1 (Glycerate PhosphoMutase)

Aliases

PreTt10592 | 92.m00134

Description

phosphoglycerate mutase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR03162 ) alpha-ribazole phosphatase
  • ( PF04807 ) Geminivirus AC4/5 conserved region
  • ( TIGR01258 ) phosphoglycerate mutase 1 family
  • ( TIGR00249 ) phosphohistidine phosphatase SixA
  • ( PF00300 ) phosphoglycerate mutase family protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05191.19.997093137033517e-262phosphoglycerate mutase 1 fami
ly protein (276 aa)
OxytrichaContig898.1.g806.0016892621718814e-118Histidine phosphatase superfam
ily (branch 1)
DictyBaseDDB_G02853112.999977985165137e-107gpmA on chromosome: 4 position
3080971 to 3081817
SGDYKL152C1.0000521619018958e-77GPM1 Tetrameric phosphoglycera
te mutase, mediates the conver
sion of 3-phosphoglycerate to
2-phosphoglycerate during glyc
olysis and the reverse reactio
n during gluconeogenesis
WormBaseWBGene000224560.000008000552149328928status:Confirmed UniProt:Q9N
590 protein_id:CCD66195.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00641240(coding)
ATGATCGGAACTTTCTTCAATCGTTTCTCTAAAAATTTGCACTCTATTAGCAAATACAAT
TTTACAAGCAACCCTGAAGCCAAATACAAGATTGTCCTTTTGAGACACGGTGAATCTGTT
TGGAATAAGGAAAATCGTTTCACCGGCTGGAAGGATGTCCAACTCTCTCCTAAAGGTATT
GAAGAAGCCAGATCTGCTGGTAAGACCTTAAAGCAAAACGGTTACGAATTCGATGTTGTT
TACACCTCTGTTTTGACCAGAGCTATCATGACTTATAATAACTTAGCTGATGAATTAGGT
TGCCACCATTTACCAGTTATTAAACACTGGAGACTCAATGAAAGACATTATGGTGCTCTC
TAAGGTTTAAATAAGACTGAAACTGCTGAAAAGCACGGTGAAGAACAAGTTAAAATATGG
AGAAGATCTTACTCAACTCCTCCTCCTGCCCTTGAACTCGATGATGAAAGATTCCCTGGA
CACGATAAGAGATACAAGCACCTCCCCATTCAAGCTTTACCTAGAACTGAAGCTTTATCT
GACTGTGTTGCAAGAGTTATTCCTTTCTGGTATGATTAAATTGTTCCTTCTGTCTTAGCC
GGTAAAAACGTTTTAGTTGTTGCCCACGGTAACTCTCTCAGATCTATCGTTAAGCATGTT
GATAATGTTTCTGAATAAGATATTATTGGTATTAACATCCCTACCAGTGTTCCTTTAATT
TATGAATTCGATGCTAACTTCAAGCCTATCAGAAACTACTACTTAGCTGATCCTGAAGAA
TTAAAGAAGAAATAAGAAGCTGTTTAGAACTAGGGTAAGAAGAAATGA


>TTHERM_00641240(protein)
MIGTFFNRFSKNLHSISKYNFTSNPEAKYKIVLLRHGESVWNKENRFTGWKDVQLSPKGI
EEARSAGKTLKQNGYEFDVVYTSVLTRAIMTYNNLADELGCHHLPVIKHWRLNERHYGAL
QGLNKTETAEKHGEEQVKIWRRSYSTPPPALELDDERFPGHDKRYKHLPIQALPRTEALS
DCVARVIPFWYDQIVPSVLAGKNVLVVAHGNSLRSIVKHVDNVSEQDIIGINIPTSVPLI
YEFDANFKPIRNYYLADPEELKKKQEAVQNQGKKK


>TTHERM_00641240(gene)
ATGATCGGAACTTTCTTCAATCGTTTCTCTAAAAATTTGCACTCTATTAGCAAATACAAT
TTTACAAGCAACCCTGAAGCCAAAGTAAGATCATCTTATTTCAAGAATACTATGCAAAAT
TCAATCTAAACCTTTTAATTAATCAATATCTCGCTCATTTTTTGAGCGCATGTCTATTGA
AATCATTCTTTTTAACCTGCAAATCATTTAAATATTTACAAAATAAACTTTATTTATGAA
ACAAATGAAAAATGTTTTGAATTTACTCATCATGATTACATTAACAAATTCTTCTTAATT
AAAAAAGTACAAGATTGTCCTTTTGAGACACGGTGAATCTGTTTGGAATAAGGAAAATCG
TTTCACCGGCTGGAAGGATGTCCAACTCTCTCCTAAAGGTATATTTATTTTAGCTATTTC
TATTTAACATTATTTGCATAGTCAATAAAATGGGTTTGTTTGCAATTAAAACAGTTTTGA
ATTGAAATTAAAAAAATAGACAGACAGTTAAATAGATAAATAGATAGATAAAACCATTTT
CAATAATTTGCAAAAAAAAGACTTTTGAGTTAAATAAACATGAGTAGAATAAAATATGTT
TTTATATAATGATTAGGTATTGAAGAAGCCAGATCTGCTGGTAAGACCTTAAAGCAAAAC
GGTTACGAATTCGATGTTGTTTACACCTCTGTTTTGACCAGAGCTATCATGACTTATAAT
AACTTAGCTGATGAATTAGGTTGCCACCATTTACCAGTTATTAAACACTGGAGACTCAAT
GAAAGACATTATGGTGCTCTCTAAGGTTTAAATAAGACTGAAACTGCTGAAAAGCACGGT
GAAGAACAAGTTAAAATATGGAGAAGATCTTACTCAACTCCTCCTCCTGCCCTTGAACTC
GATGATGAAAGATGTACCTAAATTTCCTTTTTTCTTCTTTTAAAAATTAAATTTAAATGC
TTTTAAAAATTGAGAGTTGATTTTGTTTAGTTAGTTTTATTGCTCGTTCTACTAACAAAA
TCAAATAAAAATACTTTTTGCTATCTTTTTGATAGAAAAGCTTAGTATTTTCTTTTCTAC
TTAAAACGAAAATCTCGACAATAGAAAGATTCCTTTGATTCTTTCTTTTTAATTAAAAAT
CCAAAGCTATCAAAAATCTCAACTAACTTTTGAATTCTACAAATAGTTTTTATTGTTTAT
TAATAAAAATAATTCTAATTAAATTCAAAAATAAATAGTCCCTGGACACGATAAGAGATA
CAAGCACCTCCCCATTCAAGCTTTACCTAGAACTGAAGTAACAATAATAAATACCCCCGA
AAAATAAACAATTAAACTAATTGAATAAATAAATAGGCTTTATCTGACTGTGTTGCAAGA
GTTATTCCTTTCTGGTATGATTAAATTGTTCCTTCTGTCTTAGCCGGTAAAAACGTTTTA
GTTGTTGCCCACGGTAACTCTCTCAGATCTATCGTTAAGCATGTTGATAATGTTTCTGAA
TAAGGTAAATTATCATTTTATATAGAAGAACATAAAATTTATTTTAATTTTTGGCTAATT
ATTTATAATTCTTTAATGTAAAAAGATATTATTGGTATTAACATCCCTACCAGTGTTCCT
TTAATTTATGAATTCGATGCTAACTTCAAGCCTATCAGAAACTACTACTTAGGTAACTCA
TATATTTTAAATGAGCATAACTAAATAATATAAATAAATAAATTTGATAATAATTAGCTG
ATCCTGAAGAATTAAAGAAGAAATAAGAAGCTGTTTAGAACTAGGGTAAGAAGAAATGA