Identifiers and Description

Gene Model Identifier

TTHERM_00641240

Standard Name

GPM1 (Glycerate PhosphoMutase)

Aliases

PreTt10592 | 92.m00134

Description

phosphoglycerate mutase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR03162 ) alpha-ribazole phosphatase
  • ( PF04807 ) Geminivirus AC4/5 conserved region
  • ( TIGR01258 ) phosphoglycerate mutase 1 family
  • ( TIGR00249 ) phosphohistidine phosphatase SixA
  • ( PF00300 ) phosphoglycerate mutase family protein

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
ParameciumDBGSPATP000255680014.00077536456353e-88Paramecium tetraurelia GSPATP0
0025568001 protein
PlasmoDBPF11_02087.99824663097029e-79Plasmodium falciparum 0208
ToxoDB113.m000163.00007489553728e-78Toxoplasma gondii 2,3-bisphosp
hoglycerate-dependent phosphog
lycerate mutase, (phosphoglyce
rate mutase), putative
DictyBaseDDB02313546.99742064998781e-71gpmA phosphoglycerate mutase
DictyBaseDDB02186986.99742064998781e-71gpmA phosphoglycerate mutase
CryptoDBEAK904033.99962749527073e-67Cryptosporidium parvum (Iowa)
protein EAK90403
IPI(HUMAN)IPI:IPI00549725.47.9986739015286e-62 PROT:P18669|TREMBL:Q53G35;Q6F
HK8;Q6FHU2;Q6P6D7|ENSEMBL:E NS
P00000306191;ENSP00000351067|R
EFSEQ:NP_002620;XP_93204 7;XP_
947649|H- INV:HIT000034757;HIT
000035367;HIT000044930|VEGA:OT
THUMP0 0000020190 Tax_Id=9606
Phosphoglycerate mutase 1
FlyBaseFBgn00112709.99935395741583e-59
SGDYKL152C1.99904498038481e-49GPM1 SGDID:S000001635, Chr XI
from 164390-163647, reverse co
mplement, Verified ORF, "Tetra
meric phosphoglycerate mutase,
mediates the conversion of 3-
phosphoglycerate to 2-phosphog
lycerate during glycolysis and
the reverse reaction during g
luconeogenesis"
TAIRAT1G221701.00030811626158e-33phosphoglycerate/bisphosphogly
cerate mutase family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00641240(coding)
ATGATCGGAACTTTCTTCAATCGTTTCTCTAAAAATTTGCACTCTATTAGCAAATACAAT
TTTACAAGCAACCCTGAAGCCAAATACAAGATTGTCCTTTTGAGACACGGTGAATCTGTT
TGGAATAAGGAAAATCGTTTCACCGGCTGGAAGGATGTCCAACTCTCTCCTAAAGGTATT
GAAGAAGCCAGATCTGCTGGTAAGACCTTAAAGCAAAACGGTTACGAATTCGATGTTGTT
TACACCTCTGTTTTGACCAGAGCTATCATGACTTATAATAACTTAGCTGATGAATTAGGT
TGCCACCATTTACCAGTTATTAAACACTGGAGACTCAATGAAAGACATTATGGTGCTCTC
TAAGGTTTAAATAAGACTGAAACTGCTGAAAAGCACGGTGAAGAACAAGTTAAAATATGG
AGAAGATCTTACTCAACTCCTCCTCCTGCCCTTGAACTCGATGATGAAAGATTCCCTGGA
CACGATAAGAGATACAAGCACCTCCCCATTCAAGCTTTACCTAGAACTGAAGCTTTATCT
GACTGTGTTGCAAGAGTTATTCCTTTCTGGTATGATTAAATTGTTCCTTCTGTCTTAGCC
GGTAAAAACGTTTTAGTTGTTGCCCACGGTAACTCTCTCAGATCTATCGTTAAGCATGTT
GATAATGTTTCTGAATAAGATATTATTGGTATTAACATCCCTACCAGTGTTCCTTTAATT
TATGAATTCGATGCTAACTTCAAGCCTATCAGAAACTACTACTTAGCTGATCCTGAAGAA
TTAAAGAAGAAATAAGAAGCTGTTTAGAACTAGGGTAAGAAGAAATGA


>TTHERM_00641240(protein)
MIGTFFNRFSKNLHSISKYNFTSNPEAKYKIVLLRHGESVWNKENRFTGWKDVQLSPKGI
EEARSAGKTLKQNGYEFDVVYTSVLTRAIMTYNNLADELGCHHLPVIKHWRLNERHYGAL
QGLNKTETAEKHGEEQVKIWRRSYSTPPPALELDDERFPGHDKRYKHLPIQALPRTEALS
DCVARVIPFWYDQIVPSVLAGKNVLVVAHGNSLRSIVKHVDNVSEQDIIGINIPTSVPLI
YEFDANFKPIRNYYLADPEELKKKQEAVQNQGKKK


>TTHERM_00641240(gene)
ATGATCGGAACTTTCTTCAATCGTTTCTCTAAAAATTTGCACTCTATTAGCAAATACAAT
TTTACAAGCAACCCTGAAGCCAAAGTAAGATCATCTTATTTCAAGAATACTATGCAAAAT
TCAATCTAAACCTTTTAATTAATCAATATCTCGCTCATTTTTTGAGCGCATGTCTATTGA
AATCATTCTTTTTAACCTGCAAATCATTTAAATATTTACAAAATAAACTTTATTTATGAA
ACAAATGAAAAATGTTTTGAATTTACTCATCATGATTACATTAACAAATTCTTCTTAATT
AAAAAAGTACAAGATTGTCCTTTTGAGACACGGTGAATCTGTTTGGAATAAGGAAAATCG
TTTCACCGGCTGGAAGGATGTCCAACTCTCTCCTAAAGGTATATTTATTTTAGCTATTTC
TATTTAACATTATTTGCATAGTCAATAAAATGGGTTTGTTTGCAATTAAAACAGTTTTGA
ATTGAAATTAAAAAAATAGACAGACAGTTAAATAGATAAATAGATAGATAAAACCATTTT
CAATAATTTGCAAAAAAAAGACTTTTGAGTTAAATAAACATGAGTAGAATAAAATATGTT
TTTATATAATGATTAGGTATTGAAGAAGCCAGATCTGCTGGTAAGACCTTAAAGCAAAAC
GGTTACGAATTCGATGTTGTTTACACCTCTGTTTTGACCAGAGCTATCATGACTTATAAT
AACTTAGCTGATGAATTAGGTTGCCACCATTTACCAGTTATTAAACACTGGAGACTCAAT
GAAAGACATTATGGTGCTCTCTAAGGTTTAAATAAGACTGAAACTGCTGAAAAGCACGGT
GAAGAACAAGTTAAAATATGGAGAAGATCTTACTCAACTCCTCCTCCTGCCCTTGAACTC
GATGATGAAAGATGTACCTAAATTTCCTTTTTTCTTCTTTTAAAAATTAAATTTAAATGC
TTTTAAAAATTGAGAGTTGATTTTGTTTAGTTAGTTTTATTGCTCGTTCTACTAACAAAA
TCAAATAAAAATACTTTTTGCTATCTTTTTGATAGAAAAGCTTAGTATTTTCTTTTCTAC
TTAAAACGAAAATCTCGACAATAGAAAGATTCCTTTGATTCTTTCTTTTTAATTAAAAAT
CCAAAGCTATCAAAAATCTCAACTAACTTTTGAATTCTACAAATAGTTTTTATTGTTTAT
TAATAAAAATAATTCTAATTAAATTCAAAAATAAATAGTCCCTGGACACGATAAGAGATA
CAAGCACCTCCCCATTCAAGCTTTACCTAGAACTGAAGTAACAATAATAAATACCCCCGA
AAAATAAACAATTAAACTAATTGAATAAATAAATAGGCTTTATCTGACTGTGTTGCAAGA
GTTATTCCTTTCTGGTATGATTAAATTGTTCCTTCTGTCTTAGCCGGTAAAAACGTTTTA
GTTGTTGCCCACGGTAACTCTCTCAGATCTATCGTTAAGCATGTTGATAATGTTTCTGAA
TAAGGTAAATTATCATTTTATATAGAAGAACATAAAATTTATTTTAATTTTTGGCTAATT
ATTTATAATTCTTTAATGTAAAAAGATATTATTGGTATTAACATCCCTACCAGTGTTCCT
TTAATTTATGAATTCGATGCTAACTTCAAGCCTATCAGAAACTACTACTTAGGTAACTCA
TATATTTTAAATGAGCATAACTAAATAATATAAATAAATAAATTTGATAATAATTAGCTG
ATCCTGAAGAATTAAAGAAGAAATAAGAAGCTGTTTAGAACTAGGGTAAGAAGAAATGA