Identifiers and Description

Gene Model Identifier

TTHERM_00637750

Standard Name

None

Aliases

PreTt19778 | 91.m00193 | KIN34

Description

Kinesin motor domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00225 ) Kinesin motor domain
  • ( PF06391 ) CDK-activating kinase assembly factor MAT1

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00637750

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03593.19.997093137033517e-262kinesin motor domain-containin
g protein (1597 aa)
OxytrichaContig1305.0.g203.00033207980219e-32Kinesin motor domain
SGDYGL216W4.9976494746363024e-29KIP3 Kinesin-related motor pro
tein involved in mitotic spind
le positioning
DictyBaseDDB_G02883619.001422350855153e-28kif13 on chromosome: 5 positio
n 1422250 to 1426430
WormBaseWBGene000038849.997975313387782e-28locus:osm-3 Osmotic avoidanc
e abnormal protein 3 status:
Confirmed UniProt:P46873 p
rotein_id:CCD70203.1
Stentor CoeruleusSteCoe_305380.000000000000012664165549094176

General Information

Paragraph NoGene NameParagraph Text
125TTHERM_00637750Tetrahymena thermophilia’s KIN31 protein has one domain between amino acids 31-442 with e-value 3.1e-65. The kinesin motor domain supports several cellular functions including mitosis, meiosis, and cellular transport. Kinesin proteins tend to walk toward positive ends of microtubules. The closest homologs are in Paramecium tetraurelia and Callorhinchus milii, a cartilaginous fish. Paragraph by: Jenniluyn Nguyen (undergraduate), Keck Science Department, Scripps College.

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00637750(coding)
ATGACTGATTCAGTATCTGTCACTAGTATGAGTGAGGATGAAAGAGACATCCAACCAATT
AAGAAAATTAAAAAAAACCCTAAAAAAGATGAAATGAAAGTCTTTCTTAGAATAAGACCT
TAAGACAATCTAGACTAAAGAGGCCCTATTGGAGTTAATGAGTAAGAAAGATGCATAATG
GGAATATCAAATGATGAATATCTTAATTAAAAAATAGAAGAGTTTAGAGGATTGAAATTC
AACAAAATATTTAAAGAAGATTGCTCTTAAGATGAATTTTACAATGATGTAATAGCTCCT
ATTCTTCCAGACATATTTAATTCTAAAAAAAGTTCATTGATATTTGCATATGGTGTAACA
AATAGTGGCAAAACTCATTCTATTTTGGGTTCAAGAAAGTATAATTAAAATGGTGATGGA
ATTTTGCCAAGGGTCTTATTTTTTTTAGTTGAAGCCAAAAAACTTATTAAGCAATAGATT
CAATAAAAAGTAGATTTCAATGATGATGGAATTTTCTCTGAAAATAAGATAACAATAGAT
GGCATTACAATAGATTTAAAAAATTTCATTTTTCATTCTCATAATCATCATCATAAATTA
TAAGACATTAATATTTTGTTTGAAAATTTTGAAATTTATAATGAGGATATATTTGATTTA
TAAACTGTTTAAGTATAATCGCAACCTTAATCTTTATAGCTAAATAATACATTTCACAAC
ACTCTTAGTCAGTAACTAAATACAGATCATAAGAAAGAAAAAAGGAGTGCAAGTAAAAGA
AATACAGCTTAAAAGAACAAGCTGAAAATAAAGGAAAAATTTAACAAAAAAATCTACATC
AAAGATTTGATAACAAATGAGGTAGATAGCTTTGAGTAAATTAACTGGTTGATCAAAAAT
GCAATTGAAAATAGATAAGTTCGAAATAATAATGTTAACTAAAATTCAAGTAGGTCTTAA
TGCTGCTTTAAAATAAGAGTAAAATTTACATATTGCAATTCTCTTTATAGTTAAATCGAA
GAAGAGGCAAGTTTACTCATTTTAGATCTAGCAGGTGCTGAAAGAGCTAAAAAAACAAAT
AACACAGGATCAAAAATGACAGAGTCTTGTCACATAAATAAGACATTGTTATGTTTAGGA
AACTGTATTAGATCCTTGAGGAATGGGGATGAAAATATACCTTATAGAGAATCCAAACTT
ACAAGAATATTGAATGAATATTTTGTAGATCAAAATAATGTATTGATGATAGTTCATATA
CACCCAGGAATAAGTTATACAGAAGAAAATATTAATGTTTTAAAATATGCTGCTATAGGC
CTAGAGGCAAAACTAAAGGCAGCTGCTACTATTTATGAAGGATCATCTAAACATTCATTT
TTATTGATGGATAGTGCATAGAAATCTATGAGAAACGACAAATCGATTATCAGTAACATC
TCATATGATGCTAGAAGCAATTACAGAGACTATTAAAGCATAGATTAAGATTAATTTTTT
CCTTAAATTGATAATTTTGCGAATAATACAAACTATATCCGTACTAATTATTTTACACAA
AGCGACCAAAAGAGTAATAAAGGAGGAATAAGAAACATTCATTAAAATGATTATTACTAA
ATTTAGAATTCTGATGGATAACTTATACTTGACTAAGCGATGAATTAAGAGATGGCAAAA
ACTTTGGAAGAAGAAAAAAAAAGTTTAGAAGAGAAGTATAAAAAAGAGATGGAAATCAAA
GAAATCATTCAGTAACAAAAGAGGGCAATTGAAAATTACGACTTATAGTTTGAAAATATG
ATCAATGAAGAAAATAATAAATTAAAATTGGGTTAAAGCTTATTAAATATATTTAAAGTA
CCAGATTAAATTATGTATGGTGAATTAACTGAGGATCAAGTTAACTAGGATTACTTAGAA
TAAATCAAGAGATTTTCAGATAATCAATTAAACTCTTCTAATAACAGTTAAAGAGAGATA
ATTAGAATATCTTCTTAGAAATTTAAAAATAGTTCAAATAAAAACATAGACAAAACTTAA
GAAAAGTATTAATAAACAGGAGGAGGTTATTAAGATAATTAATAGACATTTGGTAAAACA
CCATATTAAAGTTAGGAATTGGTAGAAAGAAAAAATGAAATAATTGATTAAGTTAATAAA
GAGTAAGAAAGTGATCATAAATTCTACATTAGGGATAAAAATAGTACTCATTCACTGAGA
TTAAATGAAGAAGATATGAAACTAATTAGCTAGCAAAATAAAAAATACAGTTTTGATAGC
TAAAACTCTATTTTAAATTATAAAGAAAATATTTAAATTGCATCTAATTTATATAGAGAT
GCTTCAAGTAAATACCAATAAGATGAAATGTTTTCATCGAAAAGTAATTCAATCAATTAA
AAATAAATAAATTTTAGTTAAGCATCAATTTAAAACAATCATAAAGAAAGAAACAGTCAA
AACAGTCTTTCTGATTTACAAATACATTAAATTAGAAAGAACTAATAATCTACAAGCAAT
CAGAAAGAGATGATAGATGAATAATCAAATCTTTTTAGCTAGAAATTGAGTTAGGGTGAT
TCAAGTATGATTAAAAATAGCAAGCAAATGGAAGTAGAATTATTAAAACCAGATTAAGAG
AGAAAAGTTGACATGGAAAATGAATTGGAGTAATTTTCTAAAGATAAACCTTCAGCTAAG
AAAAGTTCACTGAAAGTAAAAGGAGTTGATGTCGATAAGTATATTTAAGAAGTATATGAT
AGCTCTGCAAAAAAAGTAAATAGTGAAATTATTGATGATTCATCAGAAAGATTACTTGAA
TCTCCCAAAATATTTGAAGAAAAAGACAGTGAAAGCGAACATAATAAAACAGCTCCTAAT
TCAATAAATTCAGCAACTAATTTAGATTACTTTAAAAGAAGTCCTTCCTTAGATATACTT
TCAGTGAGCTAGTAATTGCTTTAGCTAAAGTAATAATAAGATTAAGAAAGAGAAAATTTA
TAGCAGTGCTTGAATAATGATGAGGAGGAAATAAAACAATATCTAGAATTAGATTTAGAT
GAAAATAACTTAAAATAATAAATATTAAGCTAATCTTAAAAACTGATGTAACTAATTAAA
GATAAAGAGTAAGAAATTGAATACTAAAGACAGTAATTTAATATTTAGTAAGATAATAAG
AATAAAGAAGATTAAAGAAAAATGAAAGTTTTCGAAGAGTGGATACAACAAATTTAGCAA
GAACTTAAAATTTAATCTAGATTTTTAGAGTAGAAGGAAGTTATTCTCTCTTAGTAATAA
TTAGAATTAGCTAGTCTACAGGCTAATTTATAAGAAAAGTATCGTATTTAATAATAGCAA
ATACAAGAAAACTTACTTGCTTCTGAAACTATGAAAGAATAGATACTTAAATAAGAGTAA
AAGCTTAGAGAAGAAACAGAGAGAATTGTTAACCTTCAATAAAAAGTTGAAGAAGAAATG
CAAATGCTAGTCAAAGAAAAAACTCTTCTTGGAATTCAAAAAAGTAAAAGTGATGAAATT
AAATCTAAAACTGCTACACCTTATAAGTTTAGTAAAAGTAAAAATTAAATGGATGTTGAT
TATCCAATTGCTTTATAAGACCATCATGTGAACTTTGATTTAAGCAACCTTTCATAGTCT
AAATAGGCTATGGAGGAAGAAATTGCAAAATAATCTTCTGCTCCAAGAAAATTAAGTGGA
AGCTATTATCCTGGTCATGAACCTCATTCTTAAGGTAGTAGTAAATAGAGAAAAAATTGT
GAAAAAAGCTATGCAGAAAAATAAATATAAACCTCAGCTATTCGTCCTGCTCCGAGAAAT
AATTAAAATAACTAATAAAATCATTCTGATGTAAGTGTTTATACCTATTATACTTACAGT
GAAGCAGAATCTGTTAACCCTATCTTAATGAACAACAGCTAAGGATCTTAATAGTAAAAT
AGTGCTCCAAACAGCTAAAATTCTAAAGAAAATAATCTGAAAAGCAAATACAAAAATACA
TCAAATCTTTCTCAGTAAAAAAATAAAATACAATTTTCTCCTTAAAAGGAAAATCAATCT
CTATTATTAAACTCTTCTTTAAAGCTATGCCAGCAAATATAAAATTAAAATAATTAAGTA
AGTTAATCCAAATCCTTAGAGTGTAATGAAGAAGAATAAAGTAAAAAATATTTTGATAAA
AAACCAATTGAATCAGATTTACAAAAGCTTGAACAGAAAAATTCAAATAAGATATTAAAA
GAAAAGTAAAATGAAATGGTTGATGAAAATGATTAAGTTAAAATAAACAAGCTACAAAAC
GAAAGTGAACAAAATGAAAATTAAGAAGGCTAAGAAAAAAGGAGGTAAAGAGGAAGAAAG
AAAGTTGGCTAAAAGCAGAAGAAAGCTACATCAAAGGAAAGATAAGAAAATTCTTCAGTA
GATCTTGATTCAACTTCAAAAGAAAGTGAAAGTGAAGACTAAGAAGATCTAACAAATGAA
GAATAATTAAGACAAATTCTTGATGGCATTGATTAATAGACAACTAAAAATAATAAAAAA
AGAGGAAGAAAACCAAAGTAAAGAGACAGTTTGTCTTCTAATAAATCAAGAAATTCACTG
TCTTCAGTTGACTCTGAAGCATCTTCAAGAGGACAAAAGAAACAAACTAAATAAGGCTAA
AGCTCAATAGAAAAGGATAGGATTATATGCATAAACGAAAATGAATAAAATGTTAAAATC
TCAAAAGATAATAACAAAAGATCTGCATCAAACTCTTCTGATTCTAGAAATGCTAAAAAA
AAGAATAAAAATAAATACAAAAAATGA


>TTHERM_00637750(protein)
MTDSVSVTSMSEDERDIQPIKKIKKNPKKDEMKVFLRIRPQDNLDQRGPIGVNEQERCIM
GISNDEYLNQKIEEFRGLKFNKIFKEDCSQDEFYNDVIAPILPDIFNSKKSSLIFAYGVT
NSGKTHSILGSRKYNQNGDGILPRVLFFLVEAKKLIKQQIQQKVDFNDDGIFSENKITID
GITIDLKNFIFHSHNHHHKLQDINILFENFEIYNEDIFDLQTVQVQSQPQSLQLNNTFHN
TLSQQLNTDHKKEKRSASKRNTAQKNKLKIKEKFNKKIYIKDLITNEVDSFEQINWLIKN
AIENRQVRNNNVNQNSSRSQCCFKIRVKFTYCNSLYSQIEEEASLLILDLAGAERAKKTN
NTGSKMTESCHINKTLLCLGNCIRSLRNGDENIPYRESKLTRILNEYFVDQNNVLMIVHI
HPGISYTEENINVLKYAAIGLEAKLKAAATIYEGSSKHSFLLMDSAQKSMRNDKSIISNI
SYDARSNYRDYQSIDQDQFFPQIDNFANNTNYIRTNYFTQSDQKSNKGGIRNIHQNDYYQ
IQNSDGQLILDQAMNQEMAKTLEEEKKSLEEKYKKEMEIKEIIQQQKRAIENYDLQFENM
INEENNKLKLGQSLLNIFKVPDQIMYGELTEDQVNQDYLEQIKRFSDNQLNSSNNSQREI
IRISSQKFKNSSNKNIDKTQEKYQQTGGGYQDNQQTFGKTPYQSQELVERKNEIIDQVNK
EQESDHKFYIRDKNSTHSLRLNEEDMKLISQQNKKYSFDSQNSILNYKENIQIASNLYRD
ASSKYQQDEMFSSKSNSINQKQINFSQASIQNNHKERNSQNSLSDLQIHQIRKNQQSTSN
QKEMIDEQSNLFSQKLSQGDSSMIKNSKQMEVELLKPDQERKVDMENELEQFSKDKPSAK
KSSLKVKGVDVDKYIQEVYDSSAKKVNSEIIDDSSERLLESPKIFEEKDSESEHNKTAPN
SINSATNLDYFKRSPSLDILSVSQQLLQLKQQQDQERENLQQCLNNDEEEIKQYLELDLD
ENNLKQQILSQSQKLMQLIKDKEQEIEYQRQQFNIQQDNKNKEDQRKMKVFEEWIQQIQQ
ELKIQSRFLEQKEVILSQQQLELASLQANLQEKYRIQQQQIQENLLASETMKEQILKQEQ
KLREETERIVNLQQKVEEEMQMLVKEKTLLGIQKSKSDEIKSKTATPYKFSKSKNQMDVD
YPIALQDHHVNFDLSNLSQSKQAMEEEIAKQSSAPRKLSGSYYPGHEPHSQGSSKQRKNC
EKSYAEKQIQTSAIRPAPRNNQNNQQNHSDVSVYTYYTYSEAESVNPILMNNSQGSQQQN
SAPNSQNSKENNLKSKYKNTSNLSQQKNKIQFSPQKENQSLLLNSSLKLCQQIQNQNNQV
SQSKSLECNEEEQSKKYFDKKPIESDLQKLEQKNSNKILKEKQNEMVDENDQVKINKLQN
ESEQNENQEGQEKRRQRGRKKVGQKQKKATSKERQENSSVDLDSTSKESESEDQEDLTNE
EQLRQILDGIDQQTTKNNKKRGRKPKQRDSLSSNKSRNSLSSVDSEASSRGQKKQTKQGQ
SSIEKDRIICINENEQNVKISKDNNKRSASNSSDSRNAKKKNKNKYKK


>TTHERM_00637750(gene)
ATGACTGATTCAGTATCTGTCACTAGTATGAGTGAGGATGAAAGAGACATCCAACCAATT
AAGAAAATTAAAAAAAACCCTAAAAAAGATGAAATGAAAGTCTTTCTTAGAATAAGACCT
TAAGACAATCTAGACTAAAGAGGTATGTAATCATCTCATCTGCATATTATTTTTACATTT
ATTATTAATATTAGGCCCTATTGGAGTTAATGAGTAAGAAAGATGCATAATGGGAATATC
AAATGATGAATATCTTAATTAAAAAATAGAAGAGTTTAGAGGATTGAAATTCAACAAAAT
ATTTAAAGAAGATTGCTCTTAAGATGAATTTTACAATGATGTAATAGCTCCTATTCTTCC
AGACATATTTAATTCTAGTAAAAATATTATTTGATATCTTTTTATTAAATAATATCACAA
TTAATATAGAAAAAAGTTCATTGATATTTGCATATGGTGTAACAAATAGTGGCAAAACTC
ATTCTATTTTGGGTTCAAGAAAGTATAATTAAAATGGTGATGGAATTTTGCCAAGGGTCT
TATTTTTTTTAGTTGAAGCCAAAAAACTTATTAAGCAATAGATTCAATAAAAAGTAGATT
TCAATGATGATGGAATTTTCTCTGAAAATAAGATAACAATAGATGGCATTACAATAGATT
TAAAAAATTTCATTTTTCATTCTCATAATCATCATCATAAATTATAAGACATTAATATTT
TGTTTGAAAATTTTGAAATTTATAATGAGGATATATTTGATTTATAAACTGTTTAAGTAT
AATCGCAACCTTAATCTTTATAGCTAAATAATACATTTCACAACACTCTTAGTCAGTAAC
TAAATACAGATCATAAGAAAGAAAAAAGGAGTGCAAGTAAAAGAAATACAGCTTAAAAGA
ACAAGCTGAAAATAAAGGAAAAATTTAACAAAAAAATCTACATCAAAGGTAAAATATAAA
TATTATGTGTGATTTTATAAATTATTTAACTTTTTTAAATGTTATTTAAACAGATTTGAT
AACAAATGAGGTAGATAGCTTTGAGTAAATTAACTGGTTGATCAAAAATGCAATTGAAAA
TAGATAAGTTCGAAATAATAATGTTAACTAAAATTCAAGTAGGTCTTAATGCTGCTTTAA
AATAAGAGTAAAATTTACATATTGCAATTCTCTTTATAGTTAAATCGAAGAAGAGGCAAG
TTTACTCATTTTAGATCTAGCAGGTGCTGAAAGAGCTAAAAAAACAAATAACACAGGATC
AAAAATGACAGAGTCTTGTCACATAAATAAGACATTGTTATGTTTAGGAAACTGTATTAG
ATCCTTGAGGAATGGGGATGAAAATATACCTTATAGAGAATCCAAACTTACAAGAATATT
GAATGAATATTTTGTAGATCAAAATAATGTATTGATGATAGTTCATATACACCCAGGAAT
AAGTTATACAGAAGAAAATATTAATGTTTTAAAATATGCTGCTATAGGCCTAGAGGCAAA
ACTAAAGGCAGCTGCTACTATTTATGAAGGATCATCTAAACATTCATTTTTATTGATGGA
TAGTGCATAGAAATCTATGAGAAACGACAAATCGATTATCAGTAACATCTCATATGATGC
TAGAAGCAATTACAGAGACTATTAAAGCATAGATTAAGATTAATTTTTTCCTTAAATTGA
TAATTTTGCGAATAATACAAACTATATCCGTACTAATTATTTTACACAAAGCGACCAAAA
GAGTAATAAAGGAGGAATAAGAAACATTCATTAAAATGATTATTACTAAATTTAGAATTC
TGATGGATAACTTATACTTGACTAAGCGATGTAATTATTAATTCAATCAAATTCAAATAA
TTATTGATTAAATTTTTTATAATTTAATTAGGAATTAAGAGATGGCAAAAACTTTGGAAG
AAGAAAAAAAAAGTTTAGAAGAGAAGTATAAAAAAGAGATGGAAATCAAAGAAATCATTC
AGTAACAAAAGAGGGCAATTGAAAATTACGACTTATAGTTTGAAAATATGATCAATGAAG
AAAATAATAAATTAAAATTGGGTTAAAGCTTATTAAATATATTTAAAGTACCAGATTAAA
TTATGTATGGTGAATTAACTGAGGATCAAGTTAACTAGGATTACTTAGAATAAATCAAGA
GATTTTCAGATAATCAATTAAACTCTTCTAATAACAGTTAAAGAGAGATAATTAGAATAT
CTTCTTAGAAATTTAAAAATAGTTCAAATAAAAACATAGACAAAACTTAAGAAAAGTATT
AATAAACAGGAGGAGGTTATTAAGATAATTAATAGACATTTGGTAAAACACCATATTAAA
GTTAGGAATTGGTAGAAAGAAAAAATGAAATAATTGATTAAGTTAATAAAGAGTAAGAAA
GTGATCATAAATTCTACATTAGGGATAAAAATAGTACTCATTCACTGAGATTAAATGAAG
AAGATATGAAACTAATTAGCTAGCAAAATAAAAAATACAGTTTTGATAGCTAAAACTCTA
TTTTAAATTATAAAGAAAATATTTAAATTGCATCTAATTTATATAGAGATGCTTCAAGTA
AATACCAATAAGATGAAATGTTTTCATCGAAAAGTAATTCAATCAATTAAAAATAAATAA
ATTTTAGTTAAGCATCAATTTAAAACAATCATAAAGAAAGAAACAGTCAAAACAGTCTTT
CTGATTTACAAATACATTAAATTAGAAAGAACTAATAATCTACAAGCAATCAGAAAGAGA
TGATAGATGAATAATCAAATCTTTTTAGCTAGAAATTGAGTTAGGGTGATTCAAGTATGA
TTAAAAATAGCAAGCAAATGGAAGTAGAATTATTAAAACCAGATTAAGAGAGAAAAGTTG
ACATGGAAAATGAATTGGAGTAATTTTCTAAAGATAAACCTTCAGCTAAGAAAAGTTCAC
TGAAAGTAAAAGGAGTTGATGTCGATAAGTATATTTAAGAAGTATATGATAGCTCTGCAA
AAAAAGTAAATAGTGAAATTATTGATGATTCATCAGAAAGATTACTTGAATCTCCCAAAA
TATTTGAAGAAAAAGACAGTGAAAGCGAACATAATAAAACAGCTCCTAATTCAATAAATT
CAGCAACTAATTTAGATTACTTTAAAAGAAGTCCTTCCTTAGATATACTTTCAGTGAGCT
AGTAATTGCTTTAGCTAAAGTAATAATAAGATTAAGAAAGAGAAAATTTATAGCAGTGCT
TGAATAATGATGAGGAGGAAATAAAACAATATCTAGAATTAGATTTAGATGAAAATAACT
TAAAATAATAAATATTAAGCTAATCTTAAAAACTGATGTAACTAATTAAAGATAAAGAGT
AAGAAATTGAATACTAAAGACAGTAATTTAATATTTAGTAAGATAATAAGAATAAAGAAG
ATTAAAGAAAAATGAAAGTTTTCGAAGAGTGGATACAACAAATTTAGCAAGAACTTAAAA
TTTAATCTAGATTTTTAGAGTAGAAGGAAGTTATTCTCTCTTAGTAATAATTAGAATTAG
CTAGTCTACAGGCTAATTTATAAGAAAAGTATCGTATTTAATAATAGCAAATACAAGAAA
ACTTACTTGCTTCTGAAACTATGAAAGAATAGATACTTAAATAAGAGTAAAAGCTTAGAG
AAGAAACAGAGAGAATTGTTAACCTTCAATAAAAAGTTGAAGAAGAAATGCAAATGCTAG
TCAAAGAAAAAACTCTTCTTGGAATTCAAAAAAGTAAAAGTGATGAAATTAAATCTAAAA
CTGCTACACCTTATAAGTTTAGTAAAAGTAAAAATTAAATGGATGTTGATTATCCAATTG
CTTTATAAGACCATCATGTGAACTTTGATTTAAGCAACCTTTCATAGTCTAAATAGGCTA
TGGAGGAAGAAATTGCAAAATAATCTTCTGCTCCAAGAAAATTAAGTGGAAGCTATTATC
CTGGTCATGAACCTCATTCTTAAGGTAGTAGTAAATAGAGAAAAAATTGTGAAAAAAGCT
ATGCAGAAAAATAAATATAAACCTCAGCTATTCGTCCTGCTCCGAGAAATAATTAAAATA
ACTAATAAAATCATTCTGATGTAAGTGTTTATACCTATTATACTTACAGTGAAGCAGAAT
CTGTTAACCCTATCTTAATGAACAACAGCTAAGGATCTTAATAGTAAAATAGTGCTCCAA
ACAGCTAAAATTCTAAAGAAAATAATCTGAAAAGCAAATACAAAAATACATCAAATCTTT
CTCAGTAAAAAAATAAAATACAATTTTCTCCTTAAAAGGAAAATCAATCTCTATTATTAA
ACTCTTCTTTAAAGCTATGCCAGCAAATATAAAATTAAAATAATTAAGTAAGTTAATCCA
AATCCTTAGAGTGTAATGAAGAAGAATAAAGTAAAAAATATTTTGATAAAAAACCAATTG
AATCAGATTTACAAAAGCTTGAACAGAAAAATTCAAATAAGATATTAAAAGAAAAGTAAA
ATGAAATGGTTGATGAAAATGATTAAGTTAAAATAAACAAGCTACAAAACGAAAGTGAAC
AAAATGAAAATTAAGAAGGCTAAGAAAAAAGGAGGTAAAGAGGAAGAAAGAAAGTTGGCT
AAAAGCAGAAGAAAGCTACATCAAAGGAAAGATAAGAAAATTCTTCAGTAGATCTTGATT
CAACTTCAAAAGAAAGTGAAAGTGAAGACTAAGAAGATCTAACAAATGAAGAATAATTAA
GACAAATTCTTGATGGCATTGATTAATAGACAACTAAAAATAATAAAAAAAGAGGAAGAA
AACCAAAGTAAAGAGACAGTTTGTCTTCTAATAAATCAAGAAATTCACTGTCTTCAGTTG
ACTCTGAAGCATCTTCAAGAGGACAAAAGAAACAAACTAAATAAGGCTAAAGCTCAATAG
AAAAGGATAGGATTATATGCATAAACGAAAATGAATAAAATGTTAAAATCTCAAAAGATA
ATAACAAAAGATCTGCATCAAACTCTTCTGATTCTAGAAATGCTAAAAAAAAGAATAAAA
ATAAATACAAAAAATGA