Identifiers and Description

Gene Model Identifier

TTHERM_00637350

Standard Name

ZFR2 (Zinc Finger-Related 2)

Aliases

PreTt19738 | 91.m00153

Description

Zinc finger protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF02370 ) M protein repeat
  • ( PF00097 ) zinc finger, C3HC4 type (RING
  • ( PF02403 ) Seryl-tRNA synthetase N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.7%

TetraMine Data

TTHERM_00637350

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_339460
Tetrahymena borealisEI9_03552.19.997093137033517e-262zinc finger protein (431 aa)
OxytrichaContig761.1.g410.00000019998969434520019Tetratricopeptide repeat
WormBaseWBGene000064360.00020003864201578029locus:ttn-1 status:Partially
_confirmed UniProt:G4SLD6
protein_id:CCD72173.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23251712: Xu J, Tian H, Wang W, Liang A (2012) The zinc finger protein Zfr1p is localized specifically to conjugation junction and required for sexual development in Tetrahymena thermophila. PloS one 7(12):e52799

Sequences

>TTHERM_00637350(coding)
ATGAAAAAAGAATTCATAGAAATCAAGATTAAAGGAAAAATCTAAGCAGTAGAACACATT
CTATACAATTATGATAGGTTTTATCATGAAAAAAAAAAATTAAAAGTTCCTCTACCGTTT
TTCTATGATTAATTTGCTAGCGATAAAGTGCTTGATAATATTTTAATTTACATGGATAAT
GATCATACTAACTTTTTTAATTCTATTATTTCAGTAGGATATCTTAAAAATGATTTACAA
TATTTTTAAAACACTGCATTTTCAAATAATGTAATGAATAAATTTCTAGTTTCTTCTGAA
AATCGTTAATTTACTGAATTTTTCTAAATCTATAATGAATCTAACAAAGAAGAATTAAGC
GGGTTTAACATTAATTGTGCCATGATAGAATATAATTATATTCAACAAAAAGCAGCATTT
GAAAAGAAATTAAAAGGGAATTCTTAGCCAACAACAAGCTCCTATCCTAATTAGTTAAAT
AAAAATATAAAAGAATAGTGTGATTCATTAAGAGAAGAGCTTTCAGTTATCTGTGATAAA
ATAAATATTATGAATATGAGAATGTAAAGTGATTTGTAATAGAGAAAATAAGAATCTAAT
TAATATAAACAGAGGAAAAAAAGGCTTTAAGCGCAACTTAAATAAGAAGATGAACTGAAT
AAAAAATTAGTAAGAATGATTCATGAATTAACAGCTTAAAAAAAAGTACTTGAACAGTAG
AAATAAAATCTACTTAAAAATTTTAGTGAAGAATTATAGAAAGAAGTGCAGAAAAAGCTC
AAAGACTATTAAGATATGTTAAGAGCAAAACACAAAGATGAAATTTTAAAATTGGAATAA
ACCTACAACTTTGATCTTGCCAAAAGAAAAAAGATAACTCAAGATATATCTGAGCTCAAA
AATGAAAATTAAAGTATGAAGTAGTCTGTAGAAAGTTCAAAAAAAATTATAAACGATATT
CTTATCAAATAGAGAGATAAATTAACAGAAATATAGGAAGTAAAAAAGAAAATTAATGAT
CTTGATTAGTAGTATCAATTGTTGTGTTCTTAAAGTGATTAGTAAAATGATATTTTAAAT
TGCAAGCTTTGTTAAGAGAGGCCTGCCTAAATTATTTTCCGTCCTTGTGGACATTTAATA
TATTGTGAGAGCTGTTGGATAGATTATTTGACAGAAGAAAGAGACCCTTATGTGAACCAA
GCTAAGTACATGTGCTTAGCTTGCAGAGAGTTTAGGAATGTATGCAGAATAGAAGGATTT
AGTGAATTAAAAGAATAATGA


>TTHERM_00637350(protein)
MKKEFIEIKIKGKIQAVEHILYNYDRFYHEKKKLKVPLPFFYDQFASDKVLDNILIYMDN
DHTNFFNSIISVGYLKNDLQYFQNTAFSNNVMNKFLVSSENRQFTEFFQIYNESNKEELS
GFNINCAMIEYNYIQQKAAFEKKLKGNSQPTTSSYPNQLNKNIKEQCDSLREELSVICDK
INIMNMRMQSDLQQRKQESNQYKQRKKRLQAQLKQEDELNKKLVRMIHELTAQKKVLEQQ
KQNLLKNFSEELQKEVQKKLKDYQDMLRAKHKDEILKLEQTYNFDLAKRKKITQDISELK
NENQSMKQSVESSKKIINDILIKQRDKLTEIQEVKKKINDLDQQYQLLCSQSDQQNDILN
CKLCQERPAQIIFRPCGHLIYCESCWIDYLTEERDPYVNQAKYMCLACREFRNVCRIEGF
SELKEQ


>TTHERM_00637350(gene)
ATGAAAAAAGAATTCATAGAAATCAAGATTAAAGGAAAAATCTAAGCAGTAGAACACATT
CTATACAATTATGATAGGTTTTATCATGAAAAAAAAAAATTAAAAGTTCCTCTACCGTTT
TTCTATGATTAATTTGCTAGCGATAAAGTGCTTGATAATATTTTAATTTACATGGATAAT
GATCATACTAACTTTTTTAATTCTATTATTTCAGTAGGATATCTTAAAAATGATTTACAA
TATTTTTAAAACACTGCATTTTCAAATAATGTAATGAATAAATTTCTAGTTTCTTCTGAA
AATCGTTAATTTACTGAATTTTTCTAAATCTATAATGAATCTAACAAAGAAGAATTAAGC
GGGTTTAACATTAATTGTGCCATGATAGAATATAATTATATTCAACAAAAAGCAGCATTT
GAAAAGAAATTAAAAGGGAATTCTTAGCCAACAACAAGCTCCTATCCTAATTAGTTAAAT
AAAAATAGTAAACTTGTTTGAATTTTACAAAATAATAAAAACATATTTTTAATACTTCAG
TAAAAGAATAGTGTGATTCATTAAGAGAAGAGCTTTCAGTTATCTGTGATAAAATAAATA
TTATGAATATGAGAATGTAAAGTGATTTGTAATAGAGAAAATAAGAATCTAATTAATATA
AACAGAGGAAAAAAAGGCTTTAAGCGCAACTTAAATAAGAAGATGAACTGAATAAAAAAT
TAGTAAGAATGATTCATGAGTAAATATTTTAGTTAATTAAATAGACTTTCATTTAATTTA
CTTGTTAGATTAACAGCTTAAAAAAAAGTACTTGAACAGTAGAAATAAAATCTACTTAAA
AATTTTAGTGAAGAATTATAGAAAGAAGTGCAGAAAAAGCTCAAAGACTATTAAGATATG
TTAAGAGCAAAAGTAAATAATTTTTTTAAGTTATTTTATAAAGATTAATTTACTGTAAAC
AGCACAAAGATGAAATTTTAAAATTGGAATAAACCTACAACTTTGATCTTGCCAAAAGAA
AAAAGATAACTCAAGATATATCTGAGCTCAAAAATGAAAATTAAAGTATGAAGTAGTCTG
TAGAAAGTTCAAAAAAAATTATAAACGATATTCTTATCAAATAGAGAGATAAATTAACAG
AAATATAGGAAGTAAAAAAGAAAATTAATGATCTTGATTAGTAGTATCAATTGTTGTGTT
CTTAAAGTGATTAGTAAAATGATATTTTAAATTGCAAGCTTTGTTAAGAGAGGCCTGCCT
AAATTATTTTCCGTCCTTGTGGACATTTAATATATTGTGAGAGCTGTTGGATAGATTATT
TGACAGAAGAAAGAGACCCTTATGTGAACCAAGCTAAGTACATGTGCTTAGCTTGCAGAG
AGTTTAGGAATGTATGCAGAATAGAAGGATTTAGTGAATTAAAAGAATAATGA