Identifiers and Description

Gene Model Identifier

TTHERM_00633170

Standard Name

GPR37 (Gene Protein coupled Receptor 37)

Aliases

PreTt27986 | 90.m00150 | GPCR37

Description

G protein coupled receptor; demonstrates chemorepellent receptor activity in the presence of conditioned supernatant factor

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF05462 ) Slime mold cyclic AMP receptor
  • ( PF00002 ) 7 transmembrane receptor (Secretin family)
  • ( PF01534 ) Frizzled/Smoothened family membrane region
  • ( PF00001 ) 7 transmembrane receptor (rhodopsin family)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15%

TetraMine Data

TTHERM_00633170

WebApollo

Fullscreen View

Tetrahymena Stock Center

  • ( SD01667 ) Macronucleus: GPCR3::neo3

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15804.19.997093137033517e-2627 transmembrane receptor secre
tin family protein (328 aa)
DictyBaseDDB_G02836153.9992896861436003e-19rpkA on chromosome: 4 position
1020192 to 1022856
Stentor CoeruleusSteCoe_55784.248354255291589e-18

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28685161: Zou D, Hennessey TM (2017) Behavioral Effects of a Chemorepellent Receptor Knockout Mutation in Tetrahymena thermophila. mSphere 2(4):

Sequences

>TTHERM_00633170(coding)
ATGACGATTGTTTCTAACCACAATTAGGTCAACATTATATAGATTATAGCTATTGTTGTC
AGCTCTTTTTCTCTTCTAGGAGCTATATTTATTATTGGAATATTTTTGAGTTTCAAAAAG
CTCAGGGTTTTCCCCTTTATATATGTCTTTTGGCTCAGTGTAAGTGACTTAATATCTTCT
ATAGGGTACCTTCTTGTTACTGACTCGATTGGAGACACTCCTGAATAGCTTCAAGAGGCA
AATTTTACTTGTAAAACTTAGGCTTTAATGATTAATTTTGGATAGCTTGCCTCTATTTGT
TGGACTGCAGTTATTGCCTGGACTCTCTACAACTCCACCGTTAAAGTGGTAACAAACTTA
CAACAAAAAACAGAAACAAAAATGGTTGCGATTGCTTTTGGATTTCCCCTAATTATGTCA
TTGATACCTTTAATTTTAAATGAATATGGCCCATAAGGAGGCTGGTGCTGGATAAAAAGT
GAAGGCAGCAATAAAGTATTAACATTTATTTTGGTAGGAATAGAATTTTATATTCCTCTT
TGGATAGCATTCGTATTTAATGGCATAACAATATACAGAGTAATCAAATATGTCAAGAGT
ATAACTCAAGATAAAAATTAGCTGAAACTAATCAATAGACTAACACTATATCCTCTTATT
TTATTGGTTTGCTGGAGTGCTGGTACCGTAGAAAGAGTATTTGATTTCATCGGTATCTCG
TCAGAGATACTTTCATATTTGCACATCTTCTTTGGTGGATTGTAAGGATTTTTTAATGCT
TGTGTTTACGGTCTCAATTCAAATGTCCGTAAAGTTATCAGAGAAAATCTATGCTCAAGC
CTACCATGCTTTGCAAGTGCATATATATATGAAGAATAAAACCTTAATGAAGCTGAAGAT
CATCAGCAAGATAGTAAAAAAACTGCATCCATATCCTCTGGCGAAGGCCAAGTTGAAATG
GAACAACTTAATCAATGA


>TTHERM_00633170(protein)
MTIVSNHNQVNIIQIIAIVVSSFSLLGAIFIIGIFLSFKKLRVFPFIYVFWLSVSDLISS
IGYLLVTDSIGDTPEQLQEANFTCKTQALMINFGQLASICWTAVIAWTLYNSTVKVVTNL
QQKTETKMVAIAFGFPLIMSLIPLILNEYGPQGGWCWIKSEGSNKVLTFILVGIEFYIPL
WIAFVFNGITIYRVIKYVKSITQDKNQLKLINRLTLYPLILLVCWSAGTVERVFDFIGIS
SEILSYLHIFFGGLQGFFNACVYGLNSNVRKVIRENLCSSLPCFASAYIYEEQNLNEAED
HQQDSKKTASISSGEGQVEMEQLNQ


>TTHERM_00633170(gene)
ATGACGATTGTTTCTAACCACAATTAGGTCAACATTATATAGATTATAGCTATTGTTGTC
AGCTCTTTTTCTCTTCTAGGAGCTATATTTATTATTGGAATATTTTTGAGTTTCAAAAAG
CTCAGGGTTTTCCCCTTTATATATGTCTTTTGGCTCAGTGTAAGTGACTTAATATCTTCT
ATAGGGTACCTTCTTGTTACTGACTCGATTGGAGACACTCCTGAATAGCTTCAAGAGGCA
AATTTTACTTGTAAAACTTAGGCTTTAATGATTAATTTTGGATAGCTTGCCTCTATTTGT
TGGACTGCAGTTATTGCCTGGACTCTCTACAACTCCACCGTTAAAGTGGTAACAAACTTA
CAACAAAAAACAGAAACAAAAATGGTTGCGATTGCTTTTGGATTTCCCCTAATTATGTCA
TTGATGTAATCATAATTTATTACTTACTTGAGAAAATTACGTTTTTCATACTATTAAAAT
ATCTTTAATACTTTGCTTTATTTATTAACTTTATGATAAATTAAATAGACCTTTAATTTT
AAATGAATATGGCCCATAAGGAGGCTGGTGCTGGATAAAAAGTGAAGGCAGCAATAAAGT
ATTAACATTTATTTTGGTAGGAATAGAATTTTATATTCCTCTTTGGATAGCATTCGTATT
TAATGGCATAACAATATACAGAGTAATCAAATATGTCAAGAGTATAACTCAAGATAAAAA
TTAGCTGAAACTAATCAATAGACTAACACTATATCCTCTTATTTTATTGGTTTGCTGGAG
TGCTGGTACCGTAGAAAGAGTATTTGATTTCATCGGTATCTCGTCAGAGATACTTTCATG
TAATTTATTTTTATTAAGCTATAGTAAAATAAGTAAAATTAATATTAATTTATTAATTTA
GATTTGCACATCTTCTTTGGTGGATTGTAAGGATTTTTTAATGCTTGTGTTTACGGTCTC
AATTCAAATGTCCGTAAAGTTATCAGAGAAAATCTATGCTCAAGCCTACCATGCTTTGCA
AGTGCATATATATATGAAGAATAAAACCTTAATGAAGCTGAAGATCATCAGCAAGATAGT
AAAAAAACTGCATCCATATCCTCTGGCGAAGGCCAAGTTGAAATGGAACAACTTAATCAA
TGA