Identifiers and Description

Gene Model Identifier

TTHERM_00628690

Standard Name

None

Aliases

PreTt24695 | 88.m00163 | 3822.m00685

Description

ubiquitin-conjugating enzyme

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00628690

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17264.18.003265703977305e-104ubiquitin-conjugating enzyme f
amily protein (150 aa)
OxytrichaContig4987.0.g185.000996804856152e-78Ubiquitin-conjugating enzyme
DictyBaseDDB_G02905471.0004671766404936e-76DDB_G0290547 on chromosome: 5
position 4248317 to 4249423
WormBaseWBGene000023441.000296925633081e-74locus:let-70 Ubiquitin-conju
gating enzyme E2 2 status:Co
nfirmed UniProt:P35129 pro
tein_id:CAA92745.1
SGDYBR082C9.000650761534676e-74UBC4 Ubiquitin-conjugating enz
yme (E2), mediates degradation
of abnormal or excess protein
s, including calmodulin and hi
stone H3; interacts with many
SCF ubiquitin protein ligases;
component of the cellular str
ess response
Stentor CoeruleusSteCoe_296086.639677199580735e-36

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00628690(coding)
ATGGCTTAAAAAAGAATATAAAAAGAATTGTAGGATTTGTAAAAGGATCCTCCTGGAAAC
TGTTCAGCAGGACCTGATATCTCTAAAGATAGTATTTTTAATTGGACTGCAGCAATTATG
GGACCTGAAGATTCACCTTACGCAGGAGGAGTATTTTTGTTGAATATAATATTCCCTAAC
GATTACCCATTTAAACCTCCAAGAGTCAGTTTTTAAACAAGAATATATCACCCTAATATA
AATTCAAATGGTTCTATTTGCCTTGATATCTTAAAAGATTAATGGAGTCCAGCACTTACA
ATTTCTAAAGTTTTATTAAGTATCAGCTCGTTACTAACTGATCCAAATCCAGATGATCCT
TTAGTACCTGAAATTGCAAATTAATATAGATCTAATAAAAATGAATATGTCTTAAAAAGT
TAACAGTGGACTAGAAAATATGCTATGTGA


>TTHERM_00628690(protein)
MAQKRIQKELQDLQKDPPGNCSAGPDISKDSIFNWTAAIMGPEDSPYAGGVFLLNIIFPN
DYPFKPPRVSFQTRIYHPNINSNGSICLDILKDQWSPALTISKVLLSISSLLTDPNPDDP
LVPEIANQYRSNKNEYVLKSQQWTRKYAM


>TTHERM_00628690(gene)
ATGGCTTAAAAAAGAATATAAAAAGAATTGTAGGATTTGTAAAAGGATCCTCCTGGAAAC
TGTTCAGCAGGTATATTTAGACCTCTTAACCTGTTAAACATTGATTTTAATTTACTTATA
TATAAAAATTAGGACCTGATATCTCTAAAGATAGTATTTTTAATTGGACTGCAGCAATTA
TGGGACCTGTAAAATAGGATTGATTAATAGCTATTTATAATAAAATTTAATAAAATAGGA
AGATTCACCTTACGCAGGAGGAGTATTTTTGTTGAATATAATATTCCCTAACGATTACCC
ATTTAAACCTCCAAGAGTAAAATTTGAATTAAGATTATATTGCTCATATGCAATTTTATA
ATATATTAATAGGTCAGTTTTTAAACAAGAATATATCACCCTAATATAAATTCAAATGGT
TCTATTTGCCTTGATATCTTAAAAGATTAATGGAGTCCAGCACTTACAATTTCTAAAGGT
AAATTAACAAAATTACAAAGAATTTAGTAACAATATTTTAAAAAATTAATTTTATAATAA
AACTGAAGTTTTATTAAGTATCAGCTCGTTACTAACTGATCCAAATCCAGATGATCCTTT
AGTACCTGAAATTGCAAATTAATATAGATCTAATAAAAATGAATATGTCTTAAAAAGTTA
ACAGTGGACTAGAAAATATGCTATGTGA