Identifiers and Description

Gene Model Identifier

TTHERM_00624110

Standard Name

None

Aliases

PreTt07399 | 87.m00179 | 3814.m00883

Description

Insulysin, Insulin-degrading enzyme

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.7%

TetraMine Data

TTHERM_00624110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11990.19.997093137033517e-262insulysin, Insulin-degrading e
nzyme (1152 aa)
OxytrichaContig22097.0.g353.000425225396195e-97Insulinase (Peptidase family M
16)
WormBaseWBGene000184263.9984352235938583e-87status:Partially_confirmed U
niProt:Q6A598 protein_id:CCD
67863.1
SGDYLR389C5.997798783616184e-81STE23 Metalloprotease involved
, with homolog Axl1p, in N-ter
minal processing of pro-a-fact
or to the mature form; express
ed in both haploids and diploi
ds; member of the insulin-degr
ading enzyme family
DictyBaseDDB_G02878512.998990600740728e-62DDB_G0287851 on chromosome: 5
position 822730 to 825733
Stentor CoeruleusSteCoe_71506.639677199580735e-36

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00624110(coding)
ATGAAGTAGAATACGATAGTCTAAATTGATAAAAGTCCTAATGACGATAGATAATATTTA
GGTTTTGAACTTCAAAATGGTATTAAAGTTATGGTAATAAGTGATAGTCATGCAGAAAAA
TCAGCTGCTTCACTTGATGTTTAAGTTGGTTAATTACAAGATCCAGAAGAATATTAAGGA
TTAGCACATTTTTGTGAACACATGCTTTTTATGGGCACAGCAAAATATCCTTTATAAAAC
GAATATAGCTAATATTTAAGCTAAAATGGAGGAAGTGACAACGCCTATACTGATATATTG
AATACCAATTACTACTTTGATGTTAAATCAGATGCATTTGAAGAAGCTTTAGATAGATTT
AGCTAGTTTTTTATCAGTCCTCTATTCGATGAGACTTGTGTAGAAAAAGAGATTAATGCA
ATTGAAAATGAACACTAAATGAATGTTAGTGAAGATTCCAGTCGTTTATGGGGAATATTT
AAAGCTCTAGCAAAGGAAGGAACAAAATTTCGTTAATATGGAGGAGGATGCTTACAAACT
CTTCAAAAAGAAAATATTAGAGAAGAACTGCTTAAATTTTATGAAAAATACTATAGCGCT
CATAAAATGAATTTAGTAATATATGGTCAGGAATCAATAGAAGTACTAAAAAATCTGGCA
ATAAAATATTTTTCTACAATACAAAACAAAGAAAAAGAATAAATTAGTGATGAACAGATG
AAAGAAATGGAGTTAGAGAAAATTCACCCATTCCCTAGAGAGTAGCTTTGCAAATTAGTT
AAAATCATTCCCATAAAAGATGAAGATATTATTGAGTTCTGTTGGGTAGTTGAGGATTAA
TAATAGTACTGTAATATAAAGCCAGATGATTATTTAACGCATATTTTTGGCCACGAAGGA
AAAAATTCTTTGCTTTCTTTACTTCTTGATGAAGGATTAGCAGTAGAATTGACTTCTTAT
TCAGAAAATTGCATGAATTTATTTACTATAATTGGCTTTAATATCACATTAACTCAAAGA
GGATTCTTTGAATATAAAAGGGTCTGTCATGCTGTTTTTAATTATATATAAGTCCTTAAA
AAAGAAGTTGCCAACAAAGAAGCATATGAAGAGGTAAAAGATATTGAGGCTATAAATTTT
CGCTTTTTAGAGAGAATAGCAATAAGTGAATATGTAACTAAAATTGCAGATGGACTTCAT
TGGATCCCTATGACCAAAATCTTAAAAATGAGATATGATTTCTAAAAGTACGATGAAATT
ATAATATAAAAGCTAATAGATTCTCTAACTTTAGATAATATCATAATTTATTTAAGCTCA
AAGAGTTTTGATTCACAGTTTTCTAAATCCTTTAACACCTCTCAATAAGATTTAGACACT
GTCATTGATTCTAGCCAGGTGCTAACAAAAAAAGCTTAAGAGTTAATAGAAACTCACTGC
CATAATCATTCAATAACACATCCACATGGTTCAGCTGCTGCTTAAAAAGTTAAAAAAGAT
AAAGAATTAACTTAAGAAGACTAAGCTTCTAGTTATGATACAGATCAAAATTAATTGGAT
TCTCATGGAGGAGAATCTCCAAAACTTAAAAGCCCATAAATATCAGCAAGAAAATATAGT
AAGTCTGTTGCTAAAAAATCTTATACAATTGAAGAAGAGTTTGAAGATTTTGACGATGAA
AATCATATTTATAGTATGCTAAACAGAAAATTTAGCTATTTATCATAAAAATCTGAAACA
AATGATGGAGATGAGGAATACTAAGATAATCGTAGCGATGAAAATTTTAATTATGCTAAT
GCAAAATAGAATAACAGCAAGAGTGACGATGATTCATTCATAACTGAAAAATATTTAGGA
GCTAGATATCTTGTAAGTGAAATTCCTGAAGATATTAAATCTTCTTATAATACAGAATAT
AAGCCTCTTTATAGCAAAAAAAAACTTGGTTTACCTGTTAAAAATTTATTCATTCCTAAA
AATTTTGATATACTTCCTAAGACAGATGATACAAGTAGTGCCAGTAAGTACCCAATAAAG
ATTTTTGAAAGTGAAATGAGCGAACTTTATTATAAATAAGACGATACGTTCTTTATCTGC
AAAACTTATTGTGACTTATTTATCTTTACGAATGATTGCAATCAATCTAAAACAGCTAAA
TCATTTGTATTGCAAGAAATTTGGTTAATACTTTTTGAAAACTATGTTAATGAAACTAAA
TATTTAGCTCAAATGGCTAATATAGATTTAAAATTTGAGTAGCACTACACTTCTTTTAAA
GTAAGAATAAAAGGATATAGTGATAAAATCGGTGTCTTGTTTGAAGAGTTTTTAAAGCTC
TTTAAGTCATTTAATCCAGCTGATGAAGGTTAAAGATTATTTTCAACTTTTTATGAAAGA
TAAATGTCTGATTATGATAATTACTATCGTGATGCTCCTCACTCAATTATAACTGATTTG
AGTAAGAACTGTCTACTTTCAACAGGAAAATTTACTATTAAGTAAAAAATAATGGCACTA
AAAGAAATAAGACTTTATGACATCGTTGAATTTCATAAATAGTGGTTATCCCATACTCGT
CTTGAAAGCTTGATTATGGGAAATATTAGTAAAGAAGAGGCAATATCTTGGATATAAAAA
GCTGAAAACACAATGAAAACTTTGAGAAACATTTTTGGAATACTACAAAAATCCGACATA
CCTTTGATTAAACCTAACAAAATTCTTCCAAACACCACAAATAAACTTGATTTTCTAATC
AACGAAAAAGAATTTAATCCTGAAGAAACCAACTCATGCTTATAATCACACTACTAAAGA
GGTCCAGAATCAGTAGAATCTCGTGTTATGATGAAGCTTATATAAAATTATTTAAGTGAA
CCTCTCTTTAATTAATTGCGTACTAATGAAAAACTAGGTTATATAGTCTGGTGCTGGGAT
GAGACATTTAGAGGAGTGAGTGGATTTTCATTCTTAGTTCAATCCTCCGTTTGCTCACCT
ATGCATATCTAAAATAGACTTGAAGAGTTTTTAGTAAATATGAGAAAAGAATTAAGATAA
CTTTCCCAAGAAAAATTTGAAAATATGAAACATTCCATTCTAATCAAACTCACAGAAAAG
CCTAAAACCTTACATAGAGAATTTCTATCAATGTCTGAAGAGATTTTGTTGCATAAATTT
GTATTTGATAGAAAGGAAAGAATACCACATATTTTAGAAGCAATCACTATTAATGATCTT
ATTAATGATTTTGATAACTTATTTTTTGAGTAAAAGAAAAAATTAGAAATTCACATAATA
ACAAATGATCATAAAGAAGAACAAGAATAATTAGAACAAGAACGTCTAAAATAAGAAGAC
ATCTTTATTTTATAGGATGACACTCACCTGAAATAGTTCTGCTAGTAAATTGATAGTCTT
TATTATGATTATTCAAGTCCAGTATAGTTGCAATTTTGA


>TTHERM_00624110(protein)
MKQNTIVQIDKSPNDDRQYLGFELQNGIKVMVISDSHAEKSAASLDVQVGQLQDPEEYQG
LAHFCEHMLFMGTAKYPLQNEYSQYLSQNGGSDNAYTDILNTNYYFDVKSDAFEEALDRF
SQFFISPLFDETCVEKEINAIENEHQMNVSEDSSRLWGIFKALAKEGTKFRQYGGGCLQT
LQKENIREELLKFYEKYYSAHKMNLVIYGQESIEVLKNLAIKYFSTIQNKEKEQISDEQM
KEMELEKIHPFPREQLCKLVKIIPIKDEDIIEFCWVVEDQQQYCNIKPDDYLTHIFGHEG
KNSLLSLLLDEGLAVELTSYSENCMNLFTIIGFNITLTQRGFFEYKRVCHAVFNYIQVLK
KEVANKEAYEEVKDIEAINFRFLERIAISEYVTKIADGLHWIPMTKILKMRYDFQKYDEI
IIQKLIDSLTLDNIIIYLSSKSFDSQFSKSFNTSQQDLDTVIDSSQVLTKKAQELIETHC
HNHSITHPHGSAAAQKVKKDKELTQEDQASSYDTDQNQLDSHGGESPKLKSPQISARKYS
KSVAKKSYTIEEEFEDFDDENHIYSMLNRKFSYLSQKSETNDGDEEYQDNRSDENFNYAN
AKQNNSKSDDDSFITEKYLGARYLVSEIPEDIKSSYNTEYKPLYSKKKLGLPVKNLFIPK
NFDILPKTDDTSSASKYPIKIFESEMSELYYKQDDTFFICKTYCDLFIFTNDCNQSKTAK
SFVLQEIWLILFENYVNETKYLAQMANIDLKFEQHYTSFKVRIKGYSDKIGVLFEEFLKL
FKSFNPADEGQRLFSTFYERQMSDYDNYYRDAPHSIITDLSKNCLLSTGKFTIKQKIMAL
KEIRLYDIVEFHKQWLSHTRLESLIMGNISKEEAISWIQKAENTMKTLRNIFGILQKSDI
PLIKPNKILPNTTNKLDFLINEKEFNPEETNSCLQSHYQRGPESVESRVMMKLIQNYLSE
PLFNQLRTNEKLGYIVWCWDETFRGVSGFSFLVQSSVCSPMHIQNRLEEFLVNMRKELRQ
LSQEKFENMKHSILIKLTEKPKTLHREFLSMSEEILLHKFVFDRKERIPHILEAITINDL
INDFDNLFFEQKKKLEIHIITNDHKEEQEQLEQERLKQEDIFILQDDTHLKQFCQQIDSL
YYDYSSPVQLQF


>TTHERM_00624110(gene)
ATGAAGTAGAATACGATAGTCTAAATTGATAAAAGTCCTAATGACGATAGATAATATTTA
GGTTTTGAACTTCAAAATGGTATTAAAGTTATGGTAATAAGTGATAGTCATGCAGAAAAA
TCAGCTGCTTCACTTGATGTTTAAGTTGGTTAATTACAAGATCCAGAAGAATATTAAGGA
TTAGCACATTTTTGTGAACACATGCTTTTTATGGGCACAGCAAAATATCCTTTATAAAAC
GAATATAGCTAATATTTAAGCTAAAATGGAGGAAGTGACAACGCCTATACTGATATATTG
AATACCAATTACTACTTTGATGTTAAATCAGATGCATTTGAAGAAGCTTTAGATAGATTT
AGCTAGTTTTTTATCAGTCCTCTATTCGATGAGACTTGTGTAGAAAAAGAGATTAATGCA
ATTGAAAATGAACACTAAATGAATGTTAGTGAAGATTCCAGTCGTTTATGGGGAATATTT
AAAGCTCTAGCAAAGGAAGGAACAAAATTTCGTTAATATGGAGGAGGATGCTTACAAACT
CTTCAAAAAGAAAATATTAGAGAAGAACTGCTTAAATTTTATGAAAAATACTATAGCGCT
CATAAAATGAATTTAGTAATATATGGTCAGGAATCAATAGAAGTACTAAAAAATCTGGCA
ATAAAATATTTTTCTACAATACAAAACAAAGAAAAAGAATAAATTAGGTAATACTCTATC
CATAAATGCACTTACTTCTTAATTTTACAACATTTTAATTTATAATTCTTTGATTGAAGT
CATAAATTTATTTATTTTTTACTTGATTATTTTAATTAAAGAGTTTTTAAGGCAATATCT
ATCTATTTTGTAGATAAATTTTTAGATTTTTTTGTATTTCTACTAGCATTTTGAATATAA
AAAACAAAACATTTTTTTAAATCCAACAAAATTATTAAACATTTTATATTTTACAAAATG
ATTTAAATTAGTGATGAACAGATGAAAGAAATGGAGTTAGAGAAAATTCACCCATTCCCT
AGAGAGTAGCTTTGCAAATTAGTTAAAATCATTCCCATAAAAGATGAAGATATTATTGAG
TTCTGTTGGGTAGTTGAGGATTAATAATAGTACTGTAATATAAAGCCAGATGATTATTTA
ACGCATATTTTTGGCCACGAAGGAAAAAATTCTTTGCTTTCTTTACTTCTTGATGAAGGA
TTAGCAGTAGAATTGACTTCTTATTCAGAAAATTGCATGAATTTATTTACTATAATTGGC
TTTAATATCACATTAACTCAAAGAGGATTCTTTGAATATAAAAGGGTCTGTCATGCTGTT
TTTAATTATATATAAGTCCTTAAAAAAGAAGTTGCCAACAAAGAAGCATATGAAGAGGTA
AAAGATATTGAGGCTATAAATTTTCGCTTTTTAGAGAGAATAGCAATAAGTGAATATGTA
ACTAAAATTGCAGATGGACTTCATTGGATCCCTATGACCAAAATCTTAAAAATGAGATAT
GATTTCTAAAAGTACGATGAAATTATAATATAAAAGCTAATAGATTCTCTAACTTTAGAT
AATATCATAATTTATTTAAGCTCAAAGAGTTTTGATTCACAGTTTTCTAAATCCTTTAAC
ACCTCTCAATAAGATTTAGACACTGTCATTGATTCTAGCCAGGTGCTAACAAAAAAAGCT
TAAGAGTTAATAGAAACTCACTGCCATAATCATTCAATAACACATCCACATGTAATTAAT
TTATTTATTTATTTGATCTAACTAAGCTTGGGTAAAATTTTCATCAATCTAAATTAAAAA
ATTCAATTTATATAAATTCTTCATTAATTTGACAGTTGCTTCTCTCACTACCTTACTTAT
TTTTCAATATTCTTATAAATTATTGATATTAGCATTAGCTATCAATAAACTATTCAAAAT
TAACTCTTTAAACCCTTGTTGAATTATTAATTTATTTAATAGTAATTATTCTTTTTATTT
TTAATAATTAGGGTTCAGCTGCTGCTTAAAAAGTTAAAAAAGATAAAGAATTAACTTAAG
AAGACTAAGCTTCTAGTTATGATACAGATCAAAATTAATTGGATTCTCATGGAGGAGAAT
CTCCAAAACTTAAAAGCCCATAAATATCAGCAAGAAAATATAGTAAGTCTGTTGCTAAAA
AATCTTATACAATTGAAGAAGAGTTTGAAGATTTTGACGATGAAAATCATATTTATAGTA
TGCTAAACAGAAAATTTAGCTATTTATCATAAAAATCTGAAACAAATGATGGAGATGAGG
AATACTAAGATAATCGTAGCGATGAAAATTTTAATTATGCTAATGCAAAATAGAATAACA
GCAAGAGTGACGATGATTCATTCATAACTGAAAAATATTTAGGAGCTAGATATCTTGTAA
GTGAAATTCCTGAAGATATTAAATCTTCTTATAATACAGAATATAAGCCTCTTTATAGCA
AAAAAAAACTTGGTTTACCTGTTAAAAATTTATTCATTCCTAAAAATTTTGATATACTTC
CTAAGACAGATGATACAAGTAGTGCCAGTAAGTACCCAATAAAGATTTTTGAAAGTGAAA
TGAGCGAACTTTATTATAAATAAGACGATACGTTCTTTATCTGCAAAACTTATTGTGACT
TATTTATCTTTACGAATGATTGCAATCAATCTAAAACAGCTAAATCATTTGTATTGCAAG
AAATTTGGTTAATACTTTTTGAAAACTATGTTAATGAAACTAAATATTTAGCTCAAATGG
CTAATATAGATTTAAAATTTGAGTAGCACTACACTTCTTTTAAAGTAAGAATAAAAGGAT
ATAGTGATAAAATCGGTGTCTTGTTTGAAGAGTTTTTAAAGCTCTTTAAGTCATTTAATC
CAGCTGATGAAGGTTAAAGATTATTTTCAACTTTTTATGAAAGATAAATGTCTGATTATG
ATAATTACTATCGTGATGCTCCTCACTCAATTGTAATTTTTTACTGCCAATTATTTAATT
AAATATAAATTTTTATTTTAACTCTAGATAACTGATTTGAGTAAGAACTGTCTACTTTCA
ACAGGAAAATTTACTATTAAGTAAAAAATAATGGCACTAAAAGAAATAAGACTTTATGAC
ATCGTTGAATTTCATAAATAGTGGTTATCCCATACTCGTCTTGAAAGCTTGATTATGGGA
AATATTAGTAAAGAAGAGGCAATATCTTGGATATAAAAAGCTGAAAACACAATGAAAACT
TTGAGAAACATTTTTGGAATACTACAAAAATCCGACATACCTTTGATTAAACCTAACAAA
ATTCTTCCAAACACCACAAATAAACTTGATTTTCTAATCAACGAAAAAGAATTTAATCCT
GAAGAAACCAACTCATGTAAATATTATATTTATTATTGACTGACCTAATTTTTTATTTGA
CATGAAAAGGCTTATAATCACACTACTAAAGAGGTCCAGAATCAGTAGAATCTCGTGTTA
TGATGAAGCTTATATAAAATTATTTAAGTGAACCTCTCTTTAATTAATTGCGTACTAATG
AAAAACTAGGTTATATAGTCTGGTGCTGGGATGAGACATTTAGAGGAGTGAGTGGATTTT
CATTCTTAGTTCAATCCTCCGTTTGCTCACCTATGCATATCTAAAATAGACTTGAAGAGT
TTTTAGTAAATATGAGAAAAGAATTAAGATAACTTTCCCAAGAAAAATTTGAAAATATGA
AACATTCCATTCTAATCAAACTCACAGAAAAGCCTAAAACCTTACATAGAGAATTTCTAT
CAATGTCTGAAGAGATTTTGTTGCATAAATTTGTATTTGATAGAAGTAATTAATCTTTTA
TGTGAAATTTAAAAAACTAATAAAAATATTTAAAATATAGAGGAAAGAATACCACATATT
TTAGAAGCAATCACTATTAATGATCTTATTAATGATTTTGATAACTTATTTTTTGAGTAA
AAGAAAAAATTAGAAATTCACATAATAACAAATGATCATAAAGAAGAACAAGAATAATTA
GAACAAGAACGTCTAAAATAAGAAGACATCTTTATTTTATAGGATGACACTCACCTGAAA
TAGTTCTGCTAGTAAATTGATAGTCTTTATTATGATTATTCAAGTCCAGTATAGTTGCAA
TTTTGA