Identifiers and Description

Gene Model Identifier

TTHERM_00616290

Standard Name

JUB4 (Junk Buster 4)

Aliases

PreTt19178 | 85.m00171 | 3725.m00062

Description

hypothetical protein; Heterochromatin Body Component Jub4p

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.4%

TetraMine Data

TTHERM_00616290

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18349.18.001307376279851e-107hypothetical protein (630 aa)

General Information

Paragraph NoGene NameParagraph Text
111JUB1,
COI16,
JUB6,
COI6,
COI3,
HPL2,
JUB4,
JUB2,
JUB3
This protein co-localizes with Pdd1p in heterochromatin body in the new macronucleus.

Associated Literature

  1. Ref:27466409: Kataoka K, Noto T, Mochizuki K (2016) Phosphorylation of an HP1-like protein is a prerequisite for heterochromatin body formation in Tetrahymena DNA elimination. Proceedings of the National Academy of Sciences of the United States of America 113(32):9027-32
  2. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88

Sequences

>TTHERM_00616290(coding)
ATGATTAATCAATTATTTTTATTTTTAAATTTTTATTTATATTTATTAGATTTTATATTG
AAATATTAATCTAAAAAATCTTTATAAAGTAATTTTGTTGAATATTTAATTAAATAAGAA
AACTTTTTGCTTAAAAAAGTACTCAAATACCTTCATTTGTAAATATTTGATACTAAAACT
AGTCTAAGAATGAATCAGGTAAATAGCGTAATGGTTGATAACTAAATGCTGCAATCCTTC
TCTGATTGCCTTGATTTACAACTTTTTATGTAGCATCAGTAAGAAGAAAAAGTAAAAGAA
AATTAAATGTTCTACAAGTATTTACAAAATTAATTGCAGATTTTGACTACAGACTTAGAG
AACGATAATATTTAAAAATAAATGCCAAAACAGAATAAAAATGGGATCACTATAAATAAA
ACACCTTAAAGTTAGTAGAGACTAAACAGATATTTAGAGATGAAAAGCATTATAGATATA
AATTTTAAGTAAAATATATCATTTTACATCAAATAGAGAGAATTGATTAAGTTGCTTAAA
GAGAGGTTATATTTTGTCAACTCTATGATAGCTAATAAAAGATAGGTTTATGAAATAGAT
TTAGAATCTTAAGAGACAAGAATTTTAGTTAGAGATTACTTTGAGTTAAAAGAGGATAAT
CCAGAGTTAAAGAATAATATCAACATTAATAATAACTTATCTGATAACTTAAATAATTGT
GATTTCTTTTCAGATTCATTTGATTAATCTAACAAAGCAGGTGAAGATGATTAAGATAAG
ATGGATGACTGGATTAGATCTTTTAATGATAAAGTGCAGAATTATAATTTGATAGAAGTT
GATTTTGGATTTGAGGATATTAAATAATAAGAACAATCTTTTGTTAATTCTTTGCAGTGG
ATTGTATCAGGCATGAACGGTATTTAGCTCAGTGAATCGAATAGTTCGAATTAGATTTTA
GAATAAAATTAATTACAAAACCAAAAGCAGGATATTTTTTAATCTTCTTTTCTTCAAGAC
ATAGAAAATGATAATTAGAATAAATATAGCAAAGAAAATCTAGAGCCAATTAAATTGAAC
AATTAAAATGATTCTATAAGTAAAAATCGTACTCAAAATAACAAGAATTAAATATATATA
GAGATAGAAAGTAAAGAAGATATACAAGAGAATGAGGAAATTGAAGAGGAAGAAGACTAA
GTTGAATAGGAAAAGGAAAATAAATAAGCAGTAAAATCAAAACCTTAAACTCCTTCTAAA
TTAAAAGAAAAAATGTCATTCGAAAATGGTGGTAGTAGAGGAGTAATTACAAGATCAGCA
TCTAAGAAGTTAGTTTAAATTAGTCCAGAGCAATAAGTAAAAAATTAAAGCTAAGCTCAA
GAAAAAGCTAATATTTGGAATGATTCTTGTAATTTGTAATAAATGGATAATGCAATATTT
ATATCTAATTCGATTGAATAAGAAAACTCTCCTCGAAAGGGAAATACGATTTTATAAAAA
GAATTATTGGAAATACACTCCAACTCATCTTCACTAAATAATGTTTAAAAAGAGCAGCAG
AGTAAAGAAATTTAACTTAAAAAAATGTTAAAAAAAGAAACTATAAATGAAAATAGCTAA
ATACCTTAAAAATAAGTATTAAATAACAAAAATGAAGGTTTATAAATGAAAAAAACTATA
TAAATAATAAAACAAAGCGACATCGCTTCTTCCTCAATCAAACTAAATAATATACCACCG
AATAATAGTAATATAAATTTAAATTCTTAATAATAGAAGTCTCTCTTATCAAAAGTCAAA
AATGAGTTTAGTCAGCCAGTACCTAGAATAAGCAGCGGTTAAGGATTGAGTGTAAGTAAA
ACAATAAACAATGATGCAAGCAATAAAAGCAAGTAAATTTCAAAATAAAAACAAGATCAA
CAAATGGAATTAGAAAAGGAAATAATAATAATATCTCCTTTAGAGACAAACATCATGAGT
TCTTCAGGAATATCCTCATAGAGAAGCCCAAATAACAGCTGTATCATAATAAAGCAAAAT
AAAATTGGTAAAAGAATAATAAAAGAAGATAAAAACTCTCCAAATTCGCACATCTCGAGA
GACAATCATAAAATAAGTAGCAATGGATCTGCTAACAACCAAGCAAAATAAAAAATATAA
AAAAGAAAAATTGTAAAGAGTTGA


>TTHERM_00616290(protein)
MINQLFLFLNFYLYLLDFILKYQSKKSLQSNFVEYLIKQENFLLKKVLKYLHLQIFDTKT
SLRMNQVNSVMVDNQMLQSFSDCLDLQLFMQHQQEEKVKENQMFYKYLQNQLQILTTDLE
NDNIQKQMPKQNKNGITINKTPQSQQRLNRYLEMKSIIDINFKQNISFYIKQRELIKLLK
ERLYFVNSMIANKRQVYEIDLESQETRILVRDYFELKEDNPELKNNININNNLSDNLNNC
DFFSDSFDQSNKAGEDDQDKMDDWIRSFNDKVQNYNLIEVDFGFEDIKQQEQSFVNSLQW
IVSGMNGIQLSESNSSNQILEQNQLQNQKQDIFQSSFLQDIENDNQNKYSKENLEPIKLN
NQNDSISKNRTQNNKNQIYIEIESKEDIQENEEIEEEEDQVEQEKENKQAVKSKPQTPSK
LKEKMSFENGGSRGVITRSASKKLVQISPEQQVKNQSQAQEKANIWNDSCNLQQMDNAIF
ISNSIEQENSPRKGNTILQKELLEIHSNSSSLNNVQKEQQSKEIQLKKMLKKETINENSQ
IPQKQVLNNKNEGLQMKKTIQIIKQSDIASSSIKLNNIPPNNSNINLNSQQQKSLLSKVK
NEFSQPVPRISSGQGLSVSKTINNDASNKSKQISKQKQDQQMELEKEIIIISPLETNIMS
SSGISSQRSPNNSCIIIKQNKIGKRIIKEDKNSPNSHISRDNHKISSNGSANNQAKQKIQ
KRKIVKS


>TTHERM_00616290(gene)
ATGATTAATCAATTATTTTTATTTTTAAATTTTTATTTATATTTATTAGATTTTATATTG
AAATATTAATCTAAAAAATCTTTATAAAGTAATTTTGTTGAATATTTAATTAAATAAGAA
AACTTTTTGCTTAAAAAAGTACTCAAATACCTTCATTTGTAAATATTTGATACTAAAACT
AGTCTAAGAAGTAATTTAAAATATTATTTTTTTCTAAAATTTTAGATAATAATAACTTTA
ATAGAATAATGATGTTTCATTTAAAATTGTAAAGAAGTCATATCAAAAGCTTATCATCAA
TGAGTTTTGTAAATAATATGTAAAATTAAAGATTAAGTTATTTCCTAAAAATAGCAAATC
TTAAGTTAATTTAAATGTAGTTAGCTATTGAAAAATATAGCTAAATTATTTCAAAATAAA
ATTTATTTGAAATGAAATATTTGGTATAAAAGAAGATATCTATTAAAATAGTTTCTAATA
CTATTTTATGTCATTTTAAAGTTATTTAGAGTTAGTATATTCTTATTGAGAAATTTAACT
GAAATACATATATTAAGAAACCAAAAACAATATTATCTATCTATCTATTATAATGTAAAT
TTTATTTATTTTTTTCAATTATTTAAATAAGAATAATGTATTAAGCAGAAATTATATTCT
GCCAAATAAAAAAATAATTTAATTTTTATGATAAGAGAATAAAATGTTTATTTGTTAAAC
TATGAATAATATTAAAAGTAAACTTTAGATAGCTAATATAAGTAGGTATGTTAAAACAAT
AATAGATTTCTTAAATTAGTATAAATTCTTCTGTTTTTAATGCAATATATATAGAAAAAT
TTTATTGGAATTATGGTCATTGATAATGAATTATTTACAATTATATATTATGTGTTGTTT
TGAGGATTGATTAAATAAAGAAATAAAATATTTATTATTATATAGGTAATAACATAAAGA
TGTTAATTAGTATCCTTTGTAATAATTGCTATATTTACAATGTTTTTTGATAAAATTTAA
TCAAATTATAATTTTTATAAGGATTTCTCTTAGACATAAATAAAAATATTTTTATTTATT
TAGGGGAAAGTAAAAAAATATTTATTTTCAATACTTCTACAAGAGAAAATTGTAAATAGC
TTGGCTCAAAAATAGCACAAGTTTGTATGCAAGGACTTGTAAATTATGCAAAGTTTGTTA
ATTATTGACAAGCTTTTAGTTATTTATTAGTAATAATTAATAGAGAATAATTAATAGTTA
AATTGAAAAGAGAATCAAAAATAATTCGAAAATACATTTGCTATAACCTTTTTTTTTATT
GATCAGTCAAGCAAAAAATATCTATAAAATAAGAAGTAAAATTCTAAAAATTATTGAAAT
ATAGATTTTATTTTGAGCTAAAGCATTTTTGTAAAGTGAATCAGGTAAATAGCGTAATGG
TTGATAACTAAATGCTGCAATCCTTCTCTGATTGCCTTGATTTACAACTTTTTATGTAGC
ATCAGTAAGAAGAAAAAGTAAAAGAAAATTAAATGTTCTACAAGTATTTACAAAATTAAT
TGCAGATTTTGACTACAGACTTAGAGAACGATAATATTTAAAAATAAATGCCAAAACAGA
ATAAAAATGGGATCACTATAAATAAAACACCTTAAAGTTAGTAGAGACTAAACAGATATT
TAGAGATGAAAAGCATTATAGATATAAATTTTAAGTAAAATATATCATTTTACATCAAAT
AGAGAGAATTGATTAAGTTGCTTAAAGAGAGGTTATATTTTGTCAACTCTATGATAGCTA
ATAAAAGATAGGTTTATGAAATAGATTTAGAATCTTAAGAGACAAGAATTTTAGTTAGAG
ATTACTTTGAGTTAAAAGAGGATAATCCAGAGTTAAAGAATAATATCAACATTAATAATA
ACTTATCTGATAACTTAAATAATTGTGATTTCTTTTCAGATTCATTTGATTAATCTAACA
AAGCAGGTGAAGATGATTAAGATAAGATGGATGACTGGATTAGATCTTTTAATGATAAAG
TGCAGAATTATAATTTGATAGAAGTTGATTTTGGATTTGAGGATATTAAATAATAAGAAC
AATCTTTTGTTAATTCTTTGCAGTGGATTGTATCAGGCATGAACGGTATTTAGCTCAGTG
AATCGAATAGTTCGAATTAGATTTTAGAATAAAATTAATTACAAAACCAAAAGCAGGATA
TTTTTTAATCTTCTTTTCTTCAAGACATAGAAAATGATAATTAGAATAAATATAGCAAAG
AAAATCTAGAGCCAATTAAATTGAACAATTAAAATGATTCTATAAGTAAAAATCGTACTC
AAAATAACAAGAATTAAATATATATAGAGATAGAAAGTAAAGAAGATATACAAGAGAATG
AGGAAATTGAAGAGGAAGAAGACTAAGTTGAATAGGAAAAGGAAAATAAATAAGCAGTAA
AATCAAAACCTTAAACTCCTTCTAAATTAAAAGAAAAAATGTCATTCGAAAATGGTGGTA
GTAGAGGAGTAATTACAAGATCAGCATCTAAGAAGTTAGTTTAAATTAGTCCAGAGCAAT
AAGTAAAAAATTAAAGCTAAGCTCAAGAAAAAGCTAATATTTGGAATGATTCTTGTAATT
TGTAATAAATGGATAATGCAATATTTATATCTAATTCGATTGAATAAGAAAACTCTCCTC
GAAAGGGAAATACGATTTTATAAAAAGAATTATTGGAAATACACTCCAACTCATCTTCAC
TAAATAATGTTTAAAAAGAGCAGCAGAGTAAAGAAATTTAACTTAAAAAAATGTTAAAAA
AAGAAACTATAAATGAAAATAGCTAAATACCTTAAAAATAAGTATTAAATAACAAAAATG
AAGGTTTATAAATGAAAAAAACTATATAAATAATAAAACAAAGCGACATCGCTTCTTCCT
CAATCAAACTAAATAATATACCACCGAATAATAGTAATATAAATTTAAATTCTTAATAAT
AGAAGTCTCTCTTATCAAAAGTCAAAAATGAGTTTAGTCAGCCAGTACCTAGAATAAGCA
GCGGTTAAGGATTGAGTGTAAGTAAAACAATAAACAATGATGCAAGCAATAAAAGCAAGT
AAATTTCAAAATAAAAACAAGATCAACAAATGGAATTAGAAAAGGAAATAATAATAATAT
CTCCTTTAGAGACAAACATCATGAGTTCTTCAGGAATATCCTCATAGAGAAGCCCAAATA
ACAGCTGTATCATAATAAAGCAAAATAAAATTGGTAAAAGAATAATAAAAGAAGATAAAA
ACTCTCCAAATTCGCACATCTCGAGAGACAATCATAAAATAAGTAGCAATGGATCTGCTA
ACAACCAAGCAAAATAAAAAATATAAAAAAGAAAAATTGTAAAGAGTTGA