Identifiers and Description

Gene Model Identifier

TTHERM_00594210

Standard Name

None

Aliases

PreTt25075 | 82.m00165 | 3835.m00572

Description

U1 small nuclear ribonucleoprotein 70 kDa protein; U1 small nuclear ribonucleoprotein 70 kDa

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.7%

TetraMine Data

TTHERM_00594210

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07511.11.9996161777617176e-164hypothetical protein (558 aa)
WormBaseWBGene000043901.0003081162615753e-33locus:rnp-7 status:Confirmed
UniProt:Q09584 protein_id
:CCD61618.1
DictyBaseDDB_G02680045.001425520048966e-32snrp70 on chromosome: 1 positi
on 1286207 to 1287863
OxytrichaContig15498.0.g414.0006511639687014e-23RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
Stentor CoeruleusSteCoe_313112.1151310375910805e-19
SGDYIL061C0.000000000000020000882446601127SNP1 Component of U1 snRNP req
uired for mRNA splicing via sp
liceosome; substrate of the ar
ginine methyltransferase Hmt1p
; may interact with poly(A) po
lymerase to regulate polyadeny
lation; homolog of human U1 70
K protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00594210(coding)
ATGTCTAGCTAATAACCTCCAATTATGCATCCTCCTATGCAGGGAGGTATGCCACCTCCA
CCACCTGGTTTAATGGGCCCTCCTTAGATGGGTGGTATTCCTCCTGGCGGAATGCCTCCC
CATAATATGATGCTTCCACCTGGTATGCATCCACCTCCTATGCCTGGTCCTCCTCCTGGA
ATGATGCCCCCTGGAATGTCTGCCCCTCCATATATGATGGGATAACCTCCAATGGGAGGC
GGAGGCATGGTCCCTATGCCTTACATGAGACCAATGAAATAGTTCTTCCCTTAGGAAATT
TAAAATTATTTCAAAGAAAGAAACGTTGGGTTTATCAAATCAAAGAATAAACCAAAATGC
AGAAGCTACGATGCAACCACATCTCATGGAATGTGGGATTACATTCTTTAGAAATTCGAG
AGAGGCCCACCTGTCCCTCTTGAAAAGTTTGAGACTCCTGAAGAGAAAATGATTAGAGAA
AAGAAGGAAAAAAAGGAAAAGTTAAAATAGAAAATTAGAGACGAAATGTAGAGCTGGAAT
CCATTTGATGACTAAAAATAAACTTCTGATCCTTATAAAACATTATTGATATTTAATATT
TCTTACAATGTAAATGAATCTAAATTGAAAGAACACTTCAAGGTGTATGGACCAATCAAG
TCTTGTCGCATCATTAGAAATTAAAATCAAAAGCATAGAGGTTATGGCTTCATTGAATTC
GAAAGGAAAAATGATTTTATTTCAGCCTATAAAAATGCTCACGAAAAGAAAATTGATGGC
AGAAGAATTGGAGTCGATATCGAAAGAGGCCGTACAATTTTAAGTTTTAGACCAAGAAGA
TTTGGCGGAGGATTAGGTGATTCTAGAAAATCTAGAGCTAGATCTGTGAGTGAAGAAAAC
GGCTACTTGAGTGACGACAGTGATGCTGATAAAAAGAAAAAAAGAGCTAGAAGTACATCT
TATCATTCTCGTCGTAGCAATTCAAGAAGAAGCTATTCCCGTAAAAGCCGTTCTCCATCG
AGAAGAAGAAGTCCTTCTCGCAGAAGCTACTCTAGAGAAAAGCAGAGAAAATATAGCAAT
TCTAGAAGCAGAAGCAGAAGTAACAATAAAAGGAGCAGATCACCTTCTGCTAAACCCTTG
AGAAATAAAAGCAGATCTCCTGATAAAAATGACAGGAATTCTCATGATGCTCCTTTGAGA
AAGCCAAGCAGATCTCCAAACAGAAGATCTAGAAGCAGAGATAACTCTAGAGATAAATAA
AATAATGGTTCATTGAAAAACTCTAAGAAATCCAGAAAGAGTAGATCTCGCTCTCCTCTC
AATGATAATAGAAACAGTAGAAATTACGATGATAATAATAGCAACATCTTCCCAACAAAC
GAGGAAAGATTAGAAAGAAAGGAAAAAAAATCCAAAAAGGATAGTAAGAGAGCAAATCAT
AATCGTGACGGAGTTTAAATTAATGAAGAAGAGGGAGAAATAAGAGGTGCTGAAGAAGGA
GAATGGGATAATGATCGTGATAGAAAGAAGAAGAAGAAAAAGGAAAAAAAAGATGATAAA
AAAGAGGAGAAAGGAAGCAAAAAAGAAAAAAAATCTAAAAAGGATAATTGA


>TTHERM_00594210(protein)
MSSQQPPIMHPPMQGGMPPPPPGLMGPPQMGGIPPGGMPPHNMMLPPGMHPPPMPGPPPG
MMPPGMSAPPYMMGQPPMGGGGMVPMPYMRPMKQFFPQEIQNYFKERNVGFIKSKNKPKC
RSYDATTSHGMWDYILQKFERGPPVPLEKFETPEEKMIREKKEKKEKLKQKIRDEMQSWN
PFDDQKQTSDPYKTLLIFNISYNVNESKLKEHFKVYGPIKSCRIIRNQNQKHRGYGFIEF
ERKNDFISAYKNAHEKKIDGRRIGVDIERGRTILSFRPRRFGGGLGDSRKSRARSVSEEN
GYLSDDSDADKKKKRARSTSYHSRRSNSRRSYSRKSRSPSRRRSPSRRSYSREKQRKYSN
SRSRSRSNNKRSRSPSAKPLRNKSRSPDKNDRNSHDAPLRKPSRSPNRRSRSRDNSRDKQ
NNGSLKNSKKSRKSRSRSPLNDNRNSRNYDDNNSNIFPTNEERLERKEKKSKKDSKRANH
NRDGVQINEEEGEIRGAEEGEWDNDRDRKKKKKKEKKDDKKEEKGSKKEKKSKKDN


>TTHERM_00594210(gene)
ATGTCTAGCTAATAACCTCCAATTATGCATCCTCCTATGCAGGGAGGTATGCCACCTCCA
CCACCTGGTTTAATGGGCCCTCCTTAGATGGGTGGTATTCCTCCTGGCGGAATGCCTCCC
CATAATATGATGCTTCCACCTGGTATGCATCCACCTCCTATGCCTGGTCCTCCTCCTGGA
ATGATGCCCCCTGGAATGTCTGCCCCTCCATATATGATGGGATAACCTCCAATGGGAGGC
GGAGGCATGGTCCCTATGCCTTACATGAGACCAATGAAATAGTTCTTCCCTTAGGAAATT
TAAAATTATTTCAAAGAAAGAAACGTTGGGTTTATCAAATCAAAGAATAAACCAAAATGC
AGAAGCTACGATGCAACCACATCTCATGGAATGTGGGATTACATTCTTTAGAAATTCGAG
AGAGGCCCACCTGTCCCTCTTGAAAAGTTTGAGACTCCTGAAGAGAAAATGATTAGAGAA
AAGAAGGAAAAAAAGGAAAAGTTAAAATAGAAAATTAGAGACGAAATGTAGAGCTGGAAT
CCATTTGATGACTAAAAATAAACTTCTGATCCTTATAAAACATTATTGATATTTAATATT
TCTTACAATGTAAATGAATCTAAATTGAAAGAACACTTCAAGGTGTATGGACCAATCAAG
TCTTGTCGCATCATTAGAAATTAAAATCAAAAGCATAGAGGTTATGGCTTCATTGAATTC
GAAAGGAAAAATGATTTTATTTCAGCCTATAAAAATGCTCACGAAAAGAAAATTGATGGC
AGAAGAATTGGAGTCGATATCGAAAGAGGCCGTACAATTTTAAGTTTTAGACCAAGAAGA
TTTGGCGGAGGATTAGGTAATGATGATGCTTGTTATTATTTAACTCTAACAATTTTTAAT
TTTAGTTGATTTTTTCATTAATTTATTAAAATTAACAACAATAACAATGGTAAACGATTT
TTTATTTTTGGTGATCTTCTATCATTCATTAATTTTGCACAATCATGTCATGTCATAAAT
TAAATTATCCGCCTTTGTAGCGATTGATTTCAGCAATGTTTTAACCAAAGCGAATAAGGT
AAGAAATAGCAAAGTAAATAAAGATTATAATAGGTTTGTTTATAAGCGAAATATAATAAA
TAGTTGCCAGCAAACAAAAGGTAGTTAGTTTGTTACTTTGTTTGTTTGTTAAATAGTTAG
TTAATTGATTTTCAAACAAGGATTTTAAATAGTTTATTTGCTTGTTTGTTTGTTTGGTGC
ATGCAGACTTCCAAAAGATATTCCTTTCCATTTCTGACTAATTTGAAAAAATTACTTGAG
GGATGCATGCATATTTACAAACAAGCAACCAAGCAAGCTAGCAAGTAAGTAAGCAAGCAA
ACAAGCAGTATAATCAATCATACATTTTTCTTTAATAAAACAATTCAAAAACCTAAAAAG
AGAGTCGATTCCACTAATAAGCTACTACTTACTTTATTACTACTTTTGCACACCATTTTA
TTTATAGCCCTTAAAGAATTTCAAACAAATTTCTAAGATTCTTTGAACAAACATTGATTG
AAGCAAACAATGAAAGCTGAAATGAATGAATGAATAAATGAAATCAATTAATTGATTATA
TGAATTGATTTGAGATTTATGGTGATATTATATGGCTATTCAGAGATGAATAAATAATTA
AGATAATAAAATATTTTGTAAAAATCAATATAAATGAGAAGAGAGAGATCAATCCCATCA
TACATTTTTTTAACTTAAATAGGTGATTCTAGAAAATCTAGAGCTAGATCTGTGAGTGAA
GAAAACGGCTACTTGAGTGACGACAGTGATGCTGATAAAAAGAAAAAAAGAGCTAGAAGT
ACATCTTATCATTCTCGTCGTAGCAATTCAAGAAGAAGCTATTCCCGTAAAAGCCGTTCT
CCATCGAGAAGAAGAAGTCCTTCTCGCAGAAGCTACTCTAGAGAAAAGCAGAGAAAATAT
AGCAATTCTAGAAGCAGAAGCAGAAGTAACAATAAAAGGAGCAGATCACCTTCTGCTAAA
CCCTTGAGAAATAAAAGCAGATCTCCTGATAAAAATGACAGGAATTCTCATGATGCTCCT
TTGAGAAAGCCAAGCAGATCTCCAAACAGAAGATCTAGAAGCAGAGATAACTCTAGAGAT
AAATAAAATAATGGTTCATTGAAAAACTCTAAGAAATCCAGAAAGAGTAGATCTCGCTCT
CCTCTCAATGATAATAGAAACAGTAGAAATTACGATGATAATAATAGCAACATCTTCCCA
ACAAACGAGGAAAGATTAGAAAGAAAGGAAAAAAAATCCAAAAAGGATAGTAAGAGAGCA
AATCATAATCGTGACGGAGTTTAAATTAATGAAGAAGAGGGAGAAATAAGAGGTGCTGAA
GAAGGAGAATGGGATAATGATCGTGATAGAAAGAAGAAGAAGAAAAAGGAAAAAAAAGAT
GATAAAAAAGAGGAGAAAGGAAGCAAAAAAGAAAAAAAATCTAAAAAGGATAATTGA