Identifiers and Description

Gene Model Identifier

TTHERM_00586630

Standard Name

None

Aliases

PreTt24075 | 81.m00132 | 3726.m00011

Description

chromosome condensation regulator RCC1 repeat protein; regulator of chromosome condensation (RCC1)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00415 ) Regulator of chromosome condensation (RCC1)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.4%

TetraMine Data

TTHERM_00586630

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16915.19.997093137033517e-262regulator-chromosome condensat
ion (RCC1) (403 aa)
OxytrichaContig11336.0.g85.997098480211051e-62Regulator of chromosome conden
sation (RCC1) repeat
Stentor CoeruleusSteCoe_381505.380186160021138e-32
DictyBaseDDB_G02833693.001290106883431e-24DDB_G0283369 on chromosome: 4
position 587429 to 594000
WormBaseWBGene000216851.000361553249356e-16locus:herc-1 status:Confirme
d UniProt:Q9BL11 protein_i
d:CCD73459.1
SGDYGL097W0.0000000000002999981760818895SRM1 Nucleotide exchange facto
r for Gsp1p, localizes to the
nucleus, required for nucleocy
toplasmic trafficking of macro
molecules; suppressor of the p
heromone response pathway; pot
entially phosphorylated by Cdc
28p

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00586630(coding)
ATGGAAAAAGCTTAAGATTAATTATAAATTTAATAGGGAAGTGAAAATATAATCCAGCTG
CAATAACCACAAGATGGCTTTTTATACACTTGGGGGTTAAATACTGCAGGTTGTTTAGCT
AATTAGAATGAAGATTAAGGAGAAGGTATCCCTTTCAAAGTAAAAACCAACCAAAAATTT
AAAAGTGTTTCAACAGGAGGATTTTTTGGAGCTGCAATATCTTCGAAGAATGAATTATAC
ACTTGGGGAGAAACAAAAAATTCTAGAAATGGACATCAAGCAAATAAAAATTATATATTA
GTGCCTCAAAAAATAATGAATCTTTAGAATATTTCACGTGTTTCTTGTGGAAATTGGCAC
TGCTTAGCACTAAACAATTAAAACTAACTTGAAGGTATTGCAATTAAACATATAAATGCT
GGTTTTTGCCATTCCGCTGTAGTAACATAAGAAAGAGGAGAAGTATATACCTGGGGATCT
GGCGATTACTACTAATTAGGTCATGGCAATAAATAATCCTAAAAAAAACCTCTTAAAATT
AATAATTTGAGTGGAATAGAATAAGTTTCTTGTTCTCGGGGAGAAAAAAATTGTCATACA
TTAGCAACAAGCTCTGATGGTAAAGTATATAGTTGGGGAAGTGGGTATAAAGGCAAACTT
GGACATTAAAATAGCTGGAGTCATGAAGATCCAGCAGATGAATCTCGCCCTAGACCTATT
CAATATTTATAAGAAAAAGGTATTGTAATAGCTAAATCCATATCTGGAGGTATTCATTCT
GCAGTACTATCTTAAGATGGTAGATTATTTACGTTTGGCTGCTGCTCAGATGGTAGACTT
GGCCATATTAAAGATGAAAAACATGCATGCTCAAGTTATTATTTTATGGCTGCAATAGCT
GAATCTTGA


>TTHERM_00586630(protein)
MEKAQDQLQIQQGSENIIQLQQPQDGFLYTWGLNTAGCLANQNEDQGEGIPFKVKTNQKF
KSVSTGGFFGAAISSKNELYTWGETKNSRNGHQANKNYILVPQKIMNLQNISRVSCGNWH
CLALNNQNQLEGIAIKHINAGFCHSAVVTQERGEVYTWGSGDYYQLGHGNKQSQKKPLKI
NNLSGIEQVSCSRGEKNCHTLATSSDGKVYSWGSGYKGKLGHQNSWSHEDPADESRPRPI
QYLQEKGIVIAKSISGGIHSAVLSQDGRLFTFGCCSDGRLGHIKDEKHACSSYYFMAAIA
ES


>TTHERM_00586630(gene)
ATGGAAAAAGCTTAAGATTAATTATAAATTTAATAGGGAAGTGAAAATATAATCCAGCTG
CAATAACCACAAGATGGCTTTTTATACACTTGGGGGTTAAATACTGCAGGTTGTTTAGCT
AATTAGAATGAAGATTAAGGAGAAGGTATCCCTTTCAAAGTAAAAACCAACCAAAAATTT
AAAAGTGTTTCAACAGGAGGATTTTTTGGAGCTGCAATATCTTCGAAGAATGAATTATAC
ACTTGGGGAGAAACAAAAAATTCTAGAAATGGACATCAAGCAAATAAAAATTATATATTA
GTGCCTCAAAAAATAATGAATCTTTAGAATATTTCACGTGTTTCTTGTGGAAATTGGCAC
TGCTTAGCACTAAACAATTAAAACTAAGTAACTCACTAACTAACTAAATCATTTTTAAAA
AATAATCTAAACTCATTCATTATTTATTAAAATTTTAGCTTTATGTGACAGGTCATAATA
AGTATGGAGCTTGTGGACTATATGGAATAGATGAGATTAATGGATTCTAATTGAATGACA
CAATAAAAAATATTTAGATATGTTCGATAAGTGCAGGAGATGGGTTTAGCTTGTATTTGG
ATATTAACTAATAAGTATATTCTAGTGGATTTAGATAAATGCATGGAAACAAAGAAGATT
AACATTAATATTAAATAAAAAAAATTAAAGAGCTTGAAGGTATTGCAATTAAACATATAA
ATGCTGGTTTTTGCCATTCCGCTGTAGTAACATAAGAAAGAGGAGAAGTATATACCTGGG
GATCTGGCGATTACTACTAATTAGGTCATGGCAATAAATAATCCTAAAAAAAACCTCTTA
AAATTAATAATTTGAGTGGAATAGAATAAGTTTCTTGTTCTCGGGGAGAAAAAAATTGTC
ATACATTAGCAACAAGCTCTGATGGTAAAGTATATAGTTGGGGAAGTGGGTATAAAGGCA
AACTTGGACATTAAAATAGCTGGAGTCATGAAGATCCAGCAGATGAATCTCGCCCTAGAC
CTATTCAATATTTATAAGAAAAAGGTATTGTAATAGCTAAATCCATATCTGGAGGTATTC
ATTCTGCAGTACTATCTTAAGATGGTAGATTATTTACGTTTGGCTGCTGCTCAGATGGTA
GACTTGGCCATATTAAAGATGAAAAACGTATTTATTTATATAAAGAGCCTTTACCTCGAG
AAATATAAGGACCTTTTTTAAATAATAAAATAATAGATGCATGCTCAAGTTATTATTTTA
TGGCTGCAATAGCTGAATCTTGA