Identifiers and Description

Gene Model Identifier

TTHERM_00584850

Standard Name

RIB72B

Aliases

PreTt04092 | 80.m00138 | 3675.m00036 | BBC60

Description

Microtubule inner protein (MIP), found in A tubule of ciliary microtubules.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF06565 ) Repeat of unknown function (DUF1126)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00584850

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_216110
Tetrahymena borealisEI9_15228.19.997093137033517e-262hypothetical protein (517 aa)
OxytrichaContig9514.0.g1051.9994671418645758e-169Repeat of unknown function (DU
F1126)
WormBaseWBGene000130280.000000000010004361180063202status:Partially_confirmed U
niProt:Q9XWW8 protein_id:CAA
21520.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00584850(coding)
ATGGCCTCTGGATTTCCTAAATTACCTGGTTTTGTACCTACTTAACCCATAGAATAAACT
AGCTTCAAGAGAGTTAGTGCAGCTAAACAAGAATATAATAGAGATTATTTACATAAAAAT
GTTCCTCCAGTTGTCTATCCTCTTCCTAGATAAGTTCCTAAGGAACCCCCTTCATAAAAG
GGAATGTTCAATCCCAACTACATGTCTACTACTCATGATACTTACAGACCAGTAAACTGC
CCTAATGATGTTACTGAACTTTACTAACCAACTTGGGTAAAGATGGACAGATAGGTACTT
AGATTCAATGCTTACTTTAAAGAAAGTTGTGTTGAAAGCAGTCTTGAAGCATATAGAGTA
AGAAAAGTCGTTCTTTTCTTCTATTTAGAAGATAGCTCTATTGAAATTTCTGAACCCAAG
CAAATGAATTCAGGTATTCCATAGGGTTCTTTCTTAAAGCGTTAAAAAGTATTGAAGGCT
GATGGAAGCGGTGTTTATTTAAGTCTATACGACTTTTAGATTGGTTAAGATCTTGAATTT
TTCGGCAAAATTTTCCATATTTATGACTGTGATATTTATACAAGAGAGTTTTACGAAAAT
TTGGGTATTCCCTAAGGTGCTTCTGAACTCCCTGATAGTGATAACTGGGAAAAAAAAACT
TTGAATAAATTTGTACCTGTTAAAGATCACATGCTTAAAGACTTTATGGAGCACAAACTT
GGTGGTGGTCGTGTTCCTTCATAAAAGTAATTTTTGGAAAACGATAGAAAGGTTTTAAAG
TTCTTTGTCTTCTCAGAAATTCCTTTCTTTTTACATTATTACTTGGCTGATGACACTTTA
GAAATCCGTGAAATTCATCGTTAAAACAGTGGTAGAGATCCTTTCCCTCTATATCTTAAG
AGACAAAAACTTCCCAAGTAGTTTGCTTTGAACCAACCTGGTTAAACATACGCTGAAAAC
TTTGTTAAGCCAACTGATATTAAGTTTGGTGAAGATTTAGTTGCTTTTGGAAAGAAATTC
AGAATTAATGGTTGTGATAAATACACCCAAGATTATTATAGAGAAAAGTATAACATTGAC
TTCCCTCTTGGAGAAGATTACGAGATGTAATATAGAGACATAGTTAAAAGAGAAATTCCT
CCTTACAATGGATTTGGTGATGAAGAAGATTCATTAGGATATGTTTATAGATTAATTCCT
AAGCCTCCTAGAAAGGACTTCTTCAAGTGGGTTGATAACCAAGTCACTTTAAGATTCAAT
GCTAAGTTTAATACTAATAAGCCTGAAGATATTCATAGACGCTTCATTATTACTTACTAC
TTGAACGATGACTCTCTCTAAGTTTATGAACCTGCTATCAGAAACTCAGGTATTCCTGAT
GGTAAATTCTTAGAAAAGAACAGATACAAAAATGTTTAAACTAATAACGAATACTTCTAA
CCAACCGACTTAGTTGTTGGAAAAGATGTCATTATAAATGGCTACTCCTTCCGTATTTTA
GAGTGTGATGAATACACTTTAAAGTGGTTCGCCAATAATATTGTTTAATGA


>TTHERM_00584850(protein)
MASGFPKLPGFVPTQPIEQTSFKRVSAAKQEYNRDYLHKNVPPVVYPLPRQVPKEPPSQK
GMFNPNYMSTTHDTYRPVNCPNDVTELYQPTWVKMDRQVLRFNAYFKESCVESSLEAYRV
RKVVLFFYLEDSSIEISEPKQMNSGIPQGSFLKRQKVLKADGSGVYLSLYDFQIGQDLEF
FGKIFHIYDCDIYTREFYENLGIPQGASELPDSDNWEKKTLNKFVPVKDHMLKDFMEHKL
GGGRVPSQKQFLENDRKVLKFFVFSEIPFFLHYYLADDTLEIREIHRQNSGRDPFPLYLK
RQKLPKQFALNQPGQTYAENFVKPTDIKFGEDLVAFGKKFRINGCDKYTQDYYREKYNID
FPLGEDYEMQYRDIVKREIPPYNGFGDEEDSLGYVYRLIPKPPRKDFFKWVDNQVTLRFN
AKFNTNKPEDIHRRFIITYYLNDDSLQVYEPAIRNSGIPDGKFLEKNRYKNVQTNNEYFQ
PTDLVVGKDVIINGYSFRILECDEYTLKWFANNIVQ


>TTHERM_00584850(gene)
ATGGCCTCTGGATTTCCTAAATTACCTGGTTTTGTACCTACTTAACCCATAGAAGTATGA
GATTCTTTTAAAACAAAATATAAAACAATATAAATATATTAAAATCATTTATTTTGTTCA
ATCAAACCTAAATCATATTAATTCTTTTAACTTATAAATAAAAGTAAACTAGCTTCAAGA
GAGTTAGTGCAGCTAAACAAGAATATAATAGAGATTATTTACATGTAAGATTTAATTAAA
GCATTTCTATATCTAATTTTGAGTATTATTTACCATAAAATTACCATAAAGATGATATTA
TGTTATCTTTAATATGGAGGAATACTCATAATTAATACTTATATCAACTGATATATTAAA
TATTTTCAAAATAATTAATTTAGAAAAATGTTCCTCCAGTTGTCTATCCTCTTCCTAGAT
AAGTTCCTAAGGAACCCCCTTCATAAAAGGGAATGTTCAATCCCAACTACATGTCTACTA
CTCATGATACTTACAGACCAGTAAACTGCCCTAATGATGTTACTGAACTTTACTAACCAA
CTTGGGTAAAGATGGACAGATAGGTAAAAATTTAAAATAATAATAAACGAAAAAAAATTT
GATATAATTTGATAAGTTGAATTGAAAATCATTTTAAAAGAATGCAAATAACACAAATTT
AATATAGAATGATTTGCAAAAATATAAAGCAATCTAAAAGCCATAGTGAAAATAGTTTTT
AGTTTTAAAGAACTAAAAAATTGTTTACAATTAATTATTAAAAATTTAAGTTATATTTAT
GAGGGTAAATAAATAAATAGTTAGTTAGTTAGTTAGTTAATATGTGAAATTCAAAATCAT
TAATTTATATTAAAAATAAATTTGATAATTAAGCGAATGTGAAAGCAAACTTATTTTTTT
ATAAAAGGTACTTAGATTCAATGCTTACTTTAAAGAAAGTTGTGTTGAAAGCAGTCTTGA
AGCATATAGAGTAAGAAAAGTCGTTCTTTTCTTCTATTTAGAAGATAGCTCTATTGAAAT
TTCTGAACCCAAGCAAATGAATTCAGGTATTCCATAGGGTTCTTTCTTAAAGCGTTAAAA
AGTATTGAAGGCTGATGGAAGCGGTGTTTATTTAAGTCTATACGACTTTTAGATTGGTTA
AGATCTTGAATTTTTCGGCAAAATTTTCCATATTTATGACTGTGATATTTATACAAGAGA
GTTTTACGAAAATTTGGGTATTCCCTAAGGTGCTTCTGAACTCCCTGATAGTGATAACTG
GGAAAAAAAAACTTTGAATAAATTTGTACCTGTTAAAGATCACATGCTTAAAGACTTTAT
GGAGCACAAACTTGGTAATTAAATAAATACATTATATAATTTTTAATCAAAACTTAAATG
AAAGAGACACTGTATGTTTATCTGTAGAATTCAAATTCAAATATAAAATATCCTTCTTCT
TCTATTAAAAGAAATTCATAGAATAATATTTAAAGTGAAATAAGTGATCAAAATATTAAA
TATTTATTTTTATTTAAAATAGGTGGTGGTCGTGTTCCTTCATAAAAGTAATTTTTGGAA
AACGATAGAAAGGTTTTAAAGTTCTTTGTCTTCTCAGAAATTCCTTTCTTTTTACATTAT
TACTTGGCTGATGACACTTTAGAAATCCGTGAAATTCATCGTTAAAACAGTGGTAGAGAT
CCTTTCCCTCTATATCTTAAGAGACAAAAACTTCCCAAGTAGTTTGCTTTGAACCAACCT
GGTTAAACATACGCTGAAAACTTTGTTAAGCCAACTGATATTAAGTTTGGTGAAGATTTA
GTTGCTTTTGGAAAGAAATTCAGAATTAATGGTTGTGATAAATACACCCAAGATTATTAT
AGAGAAAAGTATAACATTGACTTCCCTCTTGGAGAAGATTACGAGATGTAATATAGAGAC
ATAGTTAGTAATTAAATGATATATTTATTAACATTTTCATTTTATTAAATATAATTTTAT
ATAAATAATTGTAGAAAGAGAAATTCCTCCTTACAATGGATTTGGTGATGAAGAAGATTC
ATTAGGATATGTTTATAGATTAATTCCTAAGCCTCCTAGAAAGGACTTCTTCAAGTGGGT
TGATAACCAAGTCACTTTAAGATTCAATGCTAAGTTTAATACTAATAAGCCTGAAGATAT
TCATAGGTAATAACAAATTTAAATATAATTAAAACATATTAAAAAAAGAGAAGAGATTAA
GCTTAATTAAAAAAGAAAAAACTTTAATCTTATTTAATTTATTAGTTTTAAATAGATTAA
TTAAGTTCAAAATTTATGTTGTAGTAATAGATTAAATAATTTACAGAATAAATTATACAA
ATAGTATTTTTTTTAAATAATTGCTTAATTAATATTTTTTAAAATAGACGCTTCATTATT
ACTTACTACTTGAACGATGACTCTCTCTAAGTTTATGAACCTGCTATCAGAAACTCAGGT
ACTTACTTATTTAATTAATTAAATTCAATAAAATTAAATAATTAATTAAATTAAGCATTG
TGCTTTGATTTAAGATGATCTAATTTTTATATTATCATATTTAAAGGTATTCCTGATGGT
AAATTCTTAGAAAAGAACAGATACAAAAATGTTTAAACTAATAACGAATACTTCTAACCA
ACCGACTTAGTTGTTGGAAAAGATGTCATTATAAATGGCTACTCCTTCCGTATTTTAGAG
TGTGATGAATACACTTTAAAGTGGTTCGCCAATAATATTGTTTAATGA