Identifiers and Description

Gene Model Identifier

TTHERM_00581640

Standard Name

None

Aliases

PreTt25602 | 79.m00116 | 3827.m00830

Description

AKAP7 2-prime5-prime RNA ligase-like domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 18.2%

TetraMine Data

TTHERM_00581640

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07395.16.999950590161075e-87hypothetical protein (226 aa)
OxytrichaContig9698.0.1.g400.000000100009565553302AKAP7 25 RNA ligase-like domai
n
WormBaseWBGene000079500.00007000107212225429Uncharacterized protein C35A5.
6 status:Confirmed UniProt
:Q18474 protein_id:CAA94908.
2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00581640(coding)
ATGGAAGGTATAAATAATAAATAGGTATTATAAAATAAACAAAAAGAAACTAAATGGACT
CACTTCATTAGCTTGCCTCTCACAAAGCCACATTTAGTAGAAGCTTATAAAAAGCTGAAA
TCTGAAATAACATCAGATGATCCTGATCTTGAACCATTCTTTCTAGGAAGTTCTAAAGCA
CATATAACTCTTAATATGTTAGAATTAAATGAAGAATAAGTAGAAAAAATTCAAAAGATT
TTACCTCTACTTCATAATAAATTACCAAAATTTAATATTACTTTCAAAGGATGGGGTTAT
TTCGGAAAGAAACCTGAAAAATCGAAATATTTGTATTTAAAAATAAGCAATGGATTGTAA
GAGATAAACGATTTGTGCAACAAAATAACAGCGTTTTTAGTAGAACATGATATATTGAAT
CCTTAAAAACAAAATTTGCATAATATTAAATTAATTGGTGAATATCCTAATTAAAAATAT
CAGTTATAAACTGTTCATGCCACGTTCATGAAATCGAGGACAAAAGATACTTTTGATTGT
TCTGAAATTATAAATAAATATTCAGATTTTGAAATTAGTGGTATTGATATTAACCAGCTG
CATTGCAGCATTATCTAACCTTAAAATGCTGATCTTTATTATAATTCTCTTTGTGTTATA
AATTTAATATGA


>TTHERM_00581640(protein)
MEGINNKQVLQNKQKETKWTHFISLPLTKPHLVEAYKKLKSEITSDDPDLEPFFLGSSKA
HITLNMLELNEEQVEKIQKILPLLHNKLPKFNITFKGWGYFGKKPEKSKYLYLKISNGLQ
EINDLCNKITAFLVEHDILNPQKQNLHNIKLIGEYPNQKYQLQTVHATFMKSRTKDTFDC
SEIINKYSDFEISGIDINQLHCSIIQPQNADLYYNSLCVINLI


>TTHERM_00581640(gene)
ATGGAAGGTATAAATAATAAATAGGTATTATAAAATAAACAAAAAGAAACTAAATGGACT
CACTTCATTAGCTTGCCTCTCACAAAGCCACATTTAGTAGAAGCTTATAAAAAGCTGAAA
TCTGAAATAACATCAGATGATCCTGATCTTGAACCATTCTTTCTAGGAAGTTCTAAAGCA
CATATAACTCTTAATATGTTAGAATTAAATGAAGAATAAGTAGAAAAAATTCAAAAGATT
TTACCTCTACTTCATAATAAATTACCAAAATTTAATATTACTTTCAAAGGATGGGGTTAT
TTCGGAAAGAAACCTGAAAAATCGAAATATTTGTATTTAAAAATAAGCAATGGATTGTAA
GAGATAAACGATTTGTGCAACAAAATAACAGCGTTTTTAGTAGAACATGATATATTGAAT
CCTTAAAAACAAAATTTGCATAATATTAAATTAATTGGTGAATATCCTAATTAAAAATAT
CAGTTATAAACTGTTCATGCCACGTTCATGAAATCGAGGACAAAAGATACTTTTGATTGT
TCTGAAATTATAAATAAATATTCAGATTTTGAAATTAGTGGTATTGATATTAACCAGCTG
CATTGCAGCATTATCTAACCTTAAAATGCTGATCTTTATTATAATTCTCTTTGTGTTATA
AATTTAATATGA