Identifiers and Description

Gene Model Identifier

TTHERM_00579180

Standard Name

None

Aliases

PreTt05811 | 78.m00183 | 3733.m00078

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00036 ) EF hand
  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF04263 ) Thiamin pyrophosphokinase, catalytic domain
  • ( PF06293 ) Lipopolysaccharide kinase (Kdo/WaaP) family
  • ( PF09279 ) Phosphoinositide-specific phospholipase C, efhand-like

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00579180

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16330.19.997093137033517e-262hypothetical protein (736 aa)
OxytrichaContig22243.0.g461.000444791949842e-158Protein kinase domain
Stentor CoeruleusSteCoe_65052.970445045520691e-73
WormBaseWBGene000067795.001369568193564e-73locus:unc-43 Calcium/calmodu
lin-dependent protein kinase t
ype II status:Confirmed Un
iProt:O62305 protein_id:CAC4
2322.1
DictyBaseDDB_G02799251.99927841627239e-68mlkA on chromosome: 3 position
2752719 to 2754560
SGDYFR014C4.0018838296491823e-56CMK1 Calmodulin-dependent prot
ein kinase; may play a role in
stress response, many CA++/ca
lmodulan dependent phosphoryla
tion substrates demonstrated i
n vitro, amino acid sequence s
imilar to Cmk2p and mammalian
Cam Kinase II

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00579180(coding)
ATGGGGAATTAATGTTGCTAAGGAAACAGTCCTGGTGAAGATAAAAACACAATAAGTATG
GGTAATAAAGATTTCAATGTGAATAGCGTTTAAGGATCATCTAAAAATATGCATAATGAT
AAAGAGAAACCAAGGGAAGAAGAGTCAACAAGATAGCTTAAAGAAAAATATGGTAAGTCA
ATAGTCAGTCACAATTCAAAATAGGATTATTAAGATGGAGACGATAGATTAGTAGGCAGT
CAAACAAACAATGTCGCGTATGAGGAGCAAGTCTCAAATCATGACAAGGCTATAGACAAG
TAGGCATCTCATTAATATGGTTCATCTCAACGCGAAATTTAATAGGGAAAGGAAGAAGCT
TAGAAACAGAGTTCTAAAACAGGATCTTAATTGAATTTAAAAGGATAGTAAGCAGCTACA
TCAACAACAACAAATACAAAATCAACATCTGCTGAAACACACGCATCTGAATCAAATGGT
GTAACAAAAGATGGGTTTAAAGAAAGTACAAATAATGGTAGTGCTTAACCAATAGCTAAG
CAAGCATCTAGCGGTAAACAATCTAGCTAGAGTTAAAAAGAATAAAAATCTTCTTCAGGT
GACTAGTAGCCTGCTTCGAGCAGTAAGCATGGATTGTAAAGATTATCTAATGCAGGTTTA
CCTCCTGCACCATCTACAAATCAAGCAAAGCAAAAAAAAGAGTCCCAAAGCGTAGATGCT
AAAAAGGCTACCGAAGATGATAAATCAAAAAAGAGCTCACCATCTATATCAAAAAGTCCT
TAGCGTCCACCTGCAAAAAATTCAGCTGTTGATTTCAATATTTCAGCTGATAGTTTTATT
CACTTAAAAAAAGGAAGCATAACTTAGTAATATAAAATAGGAGAAGTACTCGGAGAAGGT
GCTTTTGGTTAAGTATCAAAAGTTGTTCATAAATCAACTGGAATGATTAGAGCTATGAAG
ACCATAAAGAAAAGTTCAATTATAAAAGAAGAAGAAGACAGACTATTCTCTGAAATGAAC
ATTCTTAAAAACTTAGATCACCCTAACATATTGAGACTCATAGAGCTTTTCTAAGATAAT
AAAAACTACTATCTTGTTACAGAGTACTGCTCAGGAGGTGAATTATTCGATAAAATTAAG
TCTATGACTCATTTTACAGAAAAAATGGCTGCAGATTACATGAAATAAATTCTCTCTGCT
GTTGTTTATTGTCATTAAAATAATATAGTCCATCGTGATCTTAAACCTGAAAATTTACTT
TTTGATTCAGATAAAAAAAATGCAAATTTGAAAGTTATTGATTTCGGTACTTCTCGTAAA
TACGATAAGGCAAAAAAGATGTCTAAGCGTTTGGGAACACCCTATTATATTGCTCCAGAA
GTTTTAGATTAAAATTATGATGAGAAGTGTGATGTGTGGAGTTGTGGCGTTATTCTTTAT
ATTTTATTATGTGGTTATCCTCCTTTTGGTGGCAGATCTGAAGATGAAATTTTAAAAAAA
GTACGTCTTGGTAAGTTTAAATTTGAACCTGAAGACTGGGACCGTATTTCAGAAGAAGCT
AAAAATTTAATTAAAAAAATGCTTACTTATGACCCTAAAAAGAGAATATCTGCTGAGTAA
GCCTTAAATGATGCTTGGATTTAAAAGAATGCTCCTGCAAACCATATTAGTACAAGGGCG
TTAAGCAACTTGTCCAATTTTTATACTAGATCAAAGTTAAAATAAGCTATCCTTACATTT
ATTGTTTCTCAGGTTGTTTCACAGTAAGATAAAGAAGAACTCCAAAAAACATTTAGATCT
CTCGATAAAAACGGTGATGGTACTTTGTCAAAAGAAGAACTCATAGATGGGTACACAACT
GTTTTAGGAGATAAAGAAAAAGCTGCTACATAAGTAGACAGAATTTTAGATGAAGTTGAT
ATCAATAAATCAGGAAAAGTAGATTTTACAGAATTTTTAATGGCAGCTTCGAACAAAGAA
ATTCTTTTGTCTAAAGCAAAAGTAGAATAATCGTTTAAAATATTTGATTAAGATGGAAAT
GGTAATATAACAAAAGATGAGCTGTAGTATATTATGGGAGATATACCTGATGAATTCTGG
AAACAAATTTTGGATGAGTGTGATACAAATAAAGATGGTATGATTTCTCAAACTGAATTT
CTTGATCTCTTAATAAATAAAAAGGGAATGCCATCATAACACTGA


>TTHERM_00579180(protein)
MGNQCCQGNSPGEDKNTISMGNKDFNVNSVQGSSKNMHNDKEKPREEESTRQLKEKYGKS
IVSHNSKQDYQDGDDRLVGSQTNNVAYEEQVSNHDKAIDKQASHQYGSSQREIQQGKEEA
QKQSSKTGSQLNLKGQQAATSTTTNTKSTSAETHASESNGVTKDGFKESTNNGSAQPIAK
QASSGKQSSQSQKEQKSSSGDQQPASSSKHGLQRLSNAGLPPAPSTNQAKQKKESQSVDA
KKATEDDKSKKSSPSISKSPQRPPAKNSAVDFNISADSFIHLKKGSITQQYKIGEVLGEG
AFGQVSKVVHKSTGMIRAMKTIKKSSIIKEEEDRLFSEMNILKNLDHPNILRLIELFQDN
KNYYLVTEYCSGGELFDKIKSMTHFTEKMAADYMKQILSAVVYCHQNNIVHRDLKPENLL
FDSDKKNANLKVIDFGTSRKYDKAKKMSKRLGTPYYIAPEVLDQNYDEKCDVWSCGVILY
ILLCGYPPFGGRSEDEILKKVRLGKFKFEPEDWDRISEEAKNLIKKMLTYDPKKRISAEQ
ALNDAWIQKNAPANHISTRALSNLSNFYTRSKLKQAILTFIVSQVVSQQDKEELQKTFRS
LDKNGDGTLSKEELIDGYTTVLGDKEKAATQVDRILDEVDINKSGKVDFTEFLMAASNKE
ILLSKAKVEQSFKIFDQDGNGNITKDELQYIMGDIPDEFWKQILDECDTNKDGMISQTEF
LDLLINKKGMPSQH


>TTHERM_00579180(gene)
ATGGGGAATTAATGTTGCTAAGGAAACAGTCCTGGTGAAGGTGTGTTAGTTTATTTTTCT
TTTTGAACTGCGCGTTAAAAAATTGCAAACTTATTCTTATTAATCTTATTGCTACATGCA
TATATATACGTTTCTCTTCATCCATCAAAAAAGAGATAAAAAATTTTATTGAGGGACATT
GCAAATTATTGAAAGACAAGTATTAATATTGCAGACTAAACACTGCGAGGAATAAGAAAA
AATTAATAGCAATTGATTTATAGCAAGCGCGTTTAATCATTGCAAACTTGAGACTTATTC
TTGAGTTTCCGCAATAGGAATTACTTAATTATTTTTGATTAACGATCATTACTAATAATA
AATAGATAAAAACACAATAAGTATGGGTAATAAAGATTTCAATGTGAATAGCGTTTAAGG
ATCATCTAAAAATATGCATAATGATAAAGAGAAACCAAGGGAAGAAGAGTCAACAAGATA
GCTTAAAGAAAAATATGTAATAAAGTTAGTTACTTAATATATGCATACCATTTTTTATGA
GATCATTAACTAGCTATCAAAGAATTAAAAGCTAACTCAAAGCATAAAAGCAAAATAGAC
AAAGATGATTCTTTTTATAAAGAAAAAGCAAGGAAATATTTTATAAACTAGTAAATAAGA
CAACAGGGAATTTTATTTTATTTAAATCAAACAAACGAAGTATTCCATAAAACCTATTTT
TTAAATTATTCAAACAAATAAAGCATATTGTTAGTTACTGATAATAAATATAAAAAATAT
TGGTCTGTAATAAATTTCAAATTCTTAAAATTAGGGTAAGTCAATAGTCAGTCACAATTC
AAAATAGGATTATTAAGATGGAGACGATAGATTAGTAGGCAGTCAAACAAACAATGTCGC
GTATGAGGAGCAAGTCTCAAATCATGACAGTAAGAAAATTAAAAATAGAATTTGGATGAA
TTTTGAAAACATAAATGATTGGTCTATTGGCTAATTAATTAATCTATTAATCAAATAAAC
AAACAAAAATACATTCATTCAATCAATCAATCTATTAGTCGATAATTTATTTAATTTCTC
ACTTTACAAATAAATTTTGAATAACAAAAGTGATAGTGCACACTATTCTTTTAAAAAATA
CAATTTTATAACCAGAATAAGCATTCTAAAAAAAACTCTAAAGTATTTAACAAGCAATAA
GCAAGCAAGGAAGTATGATTAATATATTAATCTCGTAAAGTGAAAATCCAAAAATACTAA
ACATGCTTTTGGATTAGTCTACAATTTTCAATTAAGCTTGATAAAATTAGCTAGTCAAAG
CAAAAGCAATAGATCAAATCAAATACGCTAATAATTTTTATCTCCCTACCGACCTTATAT
TTATTTTTTTAATTTAATGGCCTAGTTAACCAAATAGTATGTTATTTATTAGCGTATTAA
AGGGAAATATTTTATGGCAAATTTGTTTTTATTCATACTAAATGTGAATCTCATATTCAA
ATAAAATCAAAATGGATAATAAATAAATAATAAATTTATTTATTCATTGATTATTTTTTT
TTGTCATATTACATCGCTTAAAGCAATAGGTACTTTTTACAAGAAAAGAATAGAAATTTA
AATTATCAAACTATATGTAATAGCCGTTTGATCCAAAAATAATTATATAAATGAGGCTGT
TGATTCATATTACAAATATAAAAATGAAGCGTCTGAAAAATAAATTTAATAGAATTTTAA
ATTATAAATTTGACAGTTGTCATATTACTTAAAGTAAAAGCAAAATAAATCATAAATAAA
TGAAATTTTAGTTAATTTAATGTGAAATTTTATTATAAAATTCAATATTACACTTTATGA
TAAATCAAAATTTGATATGAATATATTATCAATTAATTTTCTAATATTAGTGCTTTTTAT
CACTTAATTAAATTTTATCTCCTGCCACCTCACACTTTTACCCTTGAAATATTATTACTA
TCTTTCAACCACACTTTTTCAAAAAGAATTAATTTAACAATTAGTTGTTGCTATTTATTA
TAGTTGCAATTTTATATTACAACTGAAAATGTTTATACTAATTGCAAACTTTACTATTCT
CAAATTACTGATTATTAGTTTAATATAACTTTTCGTAATTTAAATATTTAGAGGCTATAG
ACAAGTAGGCATCTCATTAATATGGTTCATCTCAACGCGAAATTTAATAGGGAAAGGAAG
AAGCTTAGAAACAGAGTTCTAAAACAGGATCTTAATTGAATTTAAAAGGATAGTAAGCAG
CTACATCAACAACAACAAATACAAAATCAACATCTGCTGAAACACACGCATCTGAATCAA
ATGGTGTAACAAAAGATGGGTTTAAAGAAAGTACAAATAATGGTAGTGCTTAACCAATAG
CTAAGCAAGCATCTAGCGGTAAACAATCTAGCTAGAGTTAAAAAGAATAAAAATCTTCTT
CAGGTGACTAGTAGCCTGCTTCGAGCAGTAAGCATGGATTGTAAAGATTATCTAATGCAG
GTTTACCTCCTGCACCATCTACAAATCAAGCAAAGCAAAAAAAAGAGTCCCAAAGCGTAG
ATGCTAAAAAGGCTACCGAAGATGATAAATCAAAAAAGAGCTCACCATCTATATCAAAAA
GTCCTTAGCGTCCACCTGCAAAAAATTCAGCTGTTGATTTCAATATTTCAGCTGATAGTT
TTATTCACTTAAAAAAAGGAAGCATAACTTAGTAATATAAAATAGGAGAAGTACTCGGAG
AAGGTAATTTTGAAAAAAAAAAAATCACAAAATTAATAAAATATATTTATTAATCTGTGT
GTTATCAATTTTAATTCATATTTTAAAGAAAATTGTAAAAAAATTTTTAACTCTGATTTA
TTAATTTATGAAGCTTGAACAAAAGTTAAGTAAGTTTTTTTTATGAAAAAGGTGCTTTTG
GTTAAGTATCAAAAGTTGTTCATAAATCAACTGGAATGATTAGAGCTATGAAGACCATAA
AGAAAAGTTCAATTATAAAAGAAGAAGAAGACAGACTATTCTCTGAAATGAACATTCTTA
AAAACTTAGATCACCCTAACATATTGAGACTCATAGAGCTTTTCTAAGATAATAAAAACT
ACTATCTTGTTACAGAGTATAACTTGATTTAATTATCTTAATAAATAAATTAATAAATAT
AAAATAAAAAAATTTTTAATTAAATTAATCAGGTACTGCTCAGGAGGTGAATTATTCGAT
AAAATTAAGTCTATGACTCATTTTACAGAAAAAATGGCTGCAGATTACATGAAATAAATT
CTCTCTGCTGTTGTTTATTGTCATTAAAATAATATAGTCCATCGTGATCTTAAACCTGAA
AATTTACTTTTTGATTCAGATAAAAAAAATGCAAATTTGAAAGTTATTGATTTCGGTACT
TCTCGTAAATACGATAAGGCAAAAAAGATGTCTAAGCGTTTGGGAACAGTAATTATAATT
TTCTTCATTTTTACAATATAACTTAATTTTTTCATAATTATATTCAAAAATAAAATTATT
TATTTAATAAATCTTATTTTAATACATCAAATTTGTTGTGTGTTTTGTGATATTAAAATC
AAGAAATTAATGTTTTTCTTAATAATTAATTCATATTTTTTATTTAAATAGCCCTATTAT
ATTGCTCCAGAAGTTTTAGGTAAATAGAAGAAAGAAATTCATAAATTGTTCATAGAACTT
ATTATTTTTAAAAAATAGATTAAAATTATGATGAGAAGTGTGATGTGTGGAGTTGTGGCG
TTATTCTTTATATTTTATTATGTGGTTATCCTCCTTTTGGTGGCAGATCTGAAGATGAAA
TTTTAAAAAAAGTACGTCTTGGTAAGTTTAAATTTGAACCTGAAGACTGGGACCGTATTT
CAGAAGAAGCTAAAAATTTAATTAAAAAAATGCTTACTTATGACCCTAAAAAGAGAATAT
CTGCTGAGTAAGCCTTAAATGATGCTTGGATTTAAAAGAATGCTCCTGCAAACCATATTA
GTACAAGGGCGTTAAGCAACTTGTCCAATTTTTATACTAGATCAAAGTTAAAATAAGCTA
TCCTTACATTTATTGTTTCTCAGGTTGTTTCACAGTAAGATAAAGAAGAACTCCAAAAAA
CATTTAGATCTCTCGATAAAAACGGTGATGGTACTTTGTCAAAAGAAGAACTCATAGATG
GTATAAAATCATTAAGATATTTTAATTATAAAACTCATTCTATAAATTCTTATTTAAATA
GGGTACACAACTGTTTTAGGAGATAAAGAAAAAGCTGCTACATAAGTAGACAGAATTTTA
GATGAAGTTGATATCAATAAATCAGGAAAAGTAGATTTTACAGGTAAATTTTAATTATTA
AATTCCTTAGATATTTTTTATTGATCGAGATATATTTTTATATGAAAAGAATTTTTAATG
GCAGCTTCGAACAAAGAAATTCTTTTGTCTAAAGCAAAAGTAGAATAATCGTTTAAAATA
TTTGATTAAGATGGAAATGGTAATATAACAAAAGATGAGCTGTAGTATATTATGGGAGAT
ATACCTGATGAATTCTGGAAACAAATTTTGGATGAGTGTGATACAAATAAAGATGGTATG
ATTTCTCAAACTGAATTTCTTGATCTCTTAATAAATAAAAAGGGAATGCCATCATAACAC
TGA