Identifiers and Description

Gene Model Identifier

TTHERM_00577060

Standard Name

None

Aliases

PreTt28993 | 77.m00205 | 3812.m02681

Description

microtubule-associated protein EB1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.9%

TetraMine Data

TTHERM_00577060

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04061.19.997093137033517e-262EB1 protein (418 aa)
OxytrichaContig12034.0.g942.9987037581344066e-55EB1-like C-terminal motif
DictyBaseDDB_G02836075.002276765025871e-34eb1 on chromosome: 4 position
912876 to 914543
SGDYER016W9.99967697349061e-30BIM1 Microtubule-binding prote
in that together with Kar9p ma
kes up the cortical microtubul
e capture site and delays the
exit from mitosis when the spi
ndle is oriented abnormally
WormBaseWBGene000133443.000555717977434e-27locus:ebp-1 status:Partially
_confirmed UniProt:Q9GRZ1
protein_id:CAC14408.1
Stentor CoeruleusSteCoe_290683.532628572200807e-24

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00577060(coding)
ATGTCTGAAGCTTCAATAGGTATAATGGAAGGAGCGTTCTTTGTTCCAAAGAGTGAAATT
CTTAATTGGATCAACAACTTGCTCTAGTTGAATTTGACGAAAATTGAGCAACTAGGAACA
GGATCAGTCTATTGTTAAATAATTGACGTACTTTATCCAGGCACTGTTAAAATGAATAGA
ATTAACTGGAAAGCTAGAAATGAGTGGGAATTCATAGTTAATTTGAAATATCTACAACAA
GCATTTCAAAAGAACAACATCAAAAAATACATTGAGATTGAGAAACTTTCAAAAGCAAAG
TATTAAGACAATCTTGAATTTGCTTAATGGATGAAAAGGTATTTCGACATAAATAATGGC
TAAAATAATGCTAAGGATTATGATCCTGTTGCAAAAAGAGGAATCCAAAACTCAGAAACT
GATTTTTCATTTCTAGATATGAGAGACAACTCGAGAATGGCAGCAATGAGAGGAGCTAAA
AATGATAATAGTGCCGACTAGAAGTACTTAAGAAAAAAAATGGTTACAAGAAGCAAGTCT
CCCATTTTAAAATCTTTAGAGAAAAATTAATACATCTTAGGATCAAAAAGCAAAGAATTA
AAATTAGAGAATATGTAGAAAAAGCAATTAATAGATGAGAGAGATATTCTAATTATTAAA
TTTCAAGAAATTTAAGCTATATTAGGAAAATCTAATCTAGGAGAAGCTTAAAAAATACAA
GAAATTACTTAAATATCTAATTATGTAATGAGTCTTAACTTAATACAGTCAAAAGAGTAA
ATTGAAAATGACGAAAACAATTTTAGTTCAATAAGAAAGAGAAATTCAATTGACAAATTT
TAGCATAATAATACAATCAAAGAAGAAGATAGTCCACCTAGATCTGAAAAACAAAATACC
AACGCCTAAGCCTCATAAAAGGAAAAAGTTATGAAAAATAATTCATAAATTTCTAACTCA
TCAAATTTAAATAACAATCCAAGCAGTTTAAGCAATAATAACTACACTGTAGCTAATAAC
ACAAATAAAAAATCCGTAATCCTTAACTAGCCTTTAACAGGAAATAATAATTAAAATATC
CCCAATAATAGCAACAGCAACTAAAACTCAAATAGCAATATTGAGGATGTTAAGTAAGAG
AAAGCATCTCACCCAAATAATAGAGGTAGTGTCTAAAAAACCTAAATAGAAAAAGAATTA
CACAAAAAGTAAACTTTAGCACGTGTAAATAAGCATTCTGAGTAGTTAAAATAAAAAGCC
AATTGA


>TTHERM_00577060(protein)
MSEASIGIMEGAFFVPKSEILNWINNLLQLNLTKIEQLGTGSVYCQIIDVLYPGTVKMNR
INWKARNEWEFIVNLKYLQQAFQKNNIKKYIEIEKLSKAKYQDNLEFAQWMKRYFDINNG
QNNAKDYDPVAKRGIQNSETDFSFLDMRDNSRMAAMRGAKNDNSADQKYLRKKMVTRSKS
PILKSLEKNQYILGSKSKELKLENMQKKQLIDERDILIIKFQEIQAILGKSNLGEAQKIQ
EITQISNYVMSLNLIQSKEQIENDENNFSSIRKRNSIDKFQHNNTIKEEDSPPRSEKQNT
NAQASQKEKVMKNNSQISNSSNLNNNPSSLSNNNYTVANNTNKKSVILNQPLTGNNNQNI
PNNSNSNQNSNSNIEDVKQEKASHPNNRGSVQKTQIEKELHKKQTLARVNKHSEQLKQKA
N


>TTHERM_00577060(gene)
ATGTCTGAAGCTTCAATAGGTATAATGGAAGGAGCGTTCTTTGTTCCAAAGAGTGAAATT
CTTAATTGGATCAACAACTTGCTCTAGGTATAAATTTATTTGCTAACTTTTTTAAAAATA
CAAATCTCTAACTTAATAGATAATGCCTACTTTAAAATACATTATAAAAGATGAAAAATT
CTATTTAATTTACGATTTGTTATTGCATCATAAAATATTATTTCAATTATTTCATTTATT
TCAAGAATAAATATCAATCCCAACCGTAGATATTGTATTAAAAAAATTTAGTTGAATTTG
ACGAAAATTGAGCAACTAGGAACAGGATCAGTCTATTGTTAAATAATTGACGTACTTTAT
CCAGGCACTGTTAAAATGAATAGAATTAACTGGAAAGCTAGAAATGAGTGGGAATTCATA
GTTAATTTGAAATATCTACAACAAGCATTTCAAAAGAACAACATCAAAAAATACATTGAG
GTATAAAATTTAGTTTCTTTGCTGTTAACTCACTCATTATTTATTTATATTTTAAAATGA
CGTTTGATGTTCAAATTTTTTTTGTATTTATTGAAAGAATAGAAAATTTTAAATTAAGTA
ATGTAATTTACTTGTTAAAAAATTTAAAAAAGACTTTAAAAAACTAATTAAAATAATTTA
GAATTTATTAGATTTTAATGTATTGAGCATTTTTATTTCCTAATATGTAGATTGAGAAAC
TTTCAAAAGCAAAGTATTAAGACAATCTTGAATTTGCTTAATGGATGAAAAGGTATTTCG
ACATAAATAATGGCTAAAATAATGCTAAGGATTATGATCCTGTTGCAAAAAGAGGAATCC
AAAACTCAGAAACTGATTTTTCATTTCTAGATATGAGAGACAACTCGAGAATGGCAGTAA
AACTTTACAATTTAAGTCTATTTAACATTTTTAAAAATATCTTTCTAATTAAAGGCAATG
AGAGGAGCTAAAAATGATAATAGTGCCGACTAGAAGTACTTAAGAAAAAAAATGGTTACA
AGAAGCAAGTCTCCCATTTTAAAATCTTTAGAGAAAAATTAATACATCTTAGGATCAAAA
AGCAAAGAATTAAAATTAGAGAATATGTAGAAAAAGCAATTAATAGATGAGAGAGATATT
CTAATTATTAAATTTCAAGAAATTTAAGCTATATTAGGAAAATCTAATCTAGGAGAAGCT
TAAAAAATACAAGAAATTACTTAAATATCTAATTATGTAATGAGTCTTAACTTAATACAG
TCAAAAGAGTAAATTGAAAATGACGAAAACAATTTTAGTTCAATAAGAAAGAGAAATTCA
ATTGACAAATTTTAGCATAATAATACAATCAAAGAAGAAGATAGTCCACCTAGATCTGAA
AAACAAAATACCAACGCCTAAGCCTCATAAAAGGAAAAAGTTATGAAAAATAATTCATAA
ATTTCTAACTCATCAAATTTAAATAACAATCCAAGCAGTTTAAGCAATAATAACTACACT
GTAGCTAATAACACAAATAAAAAATCCGTAATCCTTAACTAGCCTTTAACAGGAAATAAT
AATTAAAATATCCCCAATAATAGCAACAGCAACTAAAACTCAAATAGCAATATTGAGGAT
GTTAAGTAAGAGAAAGCATCTCACCCAAATAATAGAGGTAGTGTCTAAAAAACCTAAATA
GAAAAAGAATTACACAAAAAGTAAACTTTAGCACGTGTAAATAAGCATTCTGAGTAGTTA
AAATAAAAAGCCAATTGA