Identifiers and Description

Gene Model Identifier

TTHERM_00575360

Standard Name

GST62 (Glutathione S-transferase zeta 1, TtGSTz1, GSTz1)

Aliases

PreTt28926 | 77.m00138 | 3812.m02621

Description

GST62 glutathione S-transferase zeta; maleylacetoacetate isomerase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.2%

TetraMine Data

TTHERM_00575360

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04003.11.99972299831384e-147maleylacetoacetate isomerase (
221 aa)
DictyBaseDDB_G02781554.000904604388404e-59mai on chromosome: 3 position
376116 to 376878
WormBaseWBGene000017905.001636743996964e-56locus:gst-42 Probable maleyl
acetoacetate isomerase statu
s:Confirmed UniProt:Q18938
protein_id:CAA91449.1
OxytrichaContig3598.0.1.g928.002420766648515e-44Glutathione S-transferase, C-t
erminal domain
Stentor CoeruleusSteCoe_202244.780892883885469e-25
SGDYNL229C0.0000009995106777214876URE2 Nitrogen catabolite repre
ssion transcriptional regulato
r that acts by inhibition of G
LN3 transcription in good nitr
ogen source; has glutathione p
eroxidase activity and can mut
ate to acquire GST activity; a
ltered form creates [URE3] pri
on

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00575360(coding)
ATGGCTGAAAGCTCAAAGAAAATTACTCTTTACAGTTATTTCCGCTCCTCAACTTCATGG
AGAGTAAGAATAGCTCTTAATCTTAAGAAAATAGACTACAACATCATTCCTATTAACCTT
TTGAAGAGTGAATAAACTTCTGAAGAATATACTAAAATCAATCCTAACTAGGGAGTCCCT
GCTTTAAAGTATGGAGACGAGGTTATTATTGAAAGCTCTGCTATCTTAGAGTTTTTGGAA
GAAGTATTTCCTGAGCACCCACTTCTTCCTTAAGATGCAGTTAAAAGAGCTTAAATTAGA
GGCTTTTGCCAAGTAATTAACACTGCCATCCACCCTCTCTAAAATTTGAGGGTGCTTAAT
AAGATTGAAAAGGAATATAGCTAAGACAAGATTCAATGGCTCAAATTCTGGGTTACTAAG
GGTTTGACAGCAATTGAAGAATTATTAAAGAATTCTCATGGAAAATATTGCTTTGGTGAT
GAAATAACACTTGCTGACTTATTCTTGGTACCTCAAGTTCAAGGAGTTGTAGATAGATTC
CAATTTGATTTAACCCCTTTCCCCAATATTGCAGAAGTTTTAAAAAATTTAAAGGAAATT
CCTGAGTTCGTTGCTGCCTCACCCAGCAAGTAAGCTGACAATCCTGATAATCAAAAGATC
TGA


>TTHERM_00575360(protein)
MAESSKKITLYSYFRSSTSWRVRIALNLKKIDYNIIPINLLKSEQTSEEYTKINPNQGVP
ALKYGDEVIIESSAILEFLEEVFPEHPLLPQDAVKRAQIRGFCQVINTAIHPLQNLRVLN
KIEKEYSQDKIQWLKFWVTKGLTAIEELLKNSHGKYCFGDEITLADLFLVPQVQGVVDRF
QFDLTPFPNIAEVLKNLKEIPEFVAASPSKQADNPDNQKI


>TTHERM_00575360(gene)
ATGGCTGAAAGCTCAAAGAAAATTACTCTTTACAGTTATTTCCGCTCCTCAACTTCATGG
AGAGTAAGAATAGCTCTTAATCTTAAGAAAATAGACTACAACATCATTCCTATTAACCTT
TTGAAGAGTGAATAAACTTCTGAAGAATATACTAAAATCAATCCTAACTAGGTAATTAAT
TTAATTTTTTATGAGAGTAATTATAATTCTAAGAAATATAAAACACTATTAGGGAGTCCC
TGCTTTAAAGTATGGAGACGAGGTTATTATTGAAAGCTCTGCTATCTTAGAGTTTTTGGA
AGAAGTATTTCCTGAGCACCCACTTCTTCCTTAAGATGCAGTTAAAAGAGCTTAAATTAG
AGGCTTTTGCCAAGTAATTAACACTGCCATCCACCCTCTCTAAAATTTGAGGGTGCTTAA
TAAGATTGAAAAGGAATATAGCTAAGACAAGATTCAATGGCTCAAATTCTGGGTTACTAA
GGGTTTGACAGGTAATTAATTTTAATTCTATTATAATGAATGAGCGTTCAATAATTTAAA
AAATATATAAAGCAATTGAAGAATTATTAAAGAATTCTCATGGAAAATATTGCTTTGGTG
ATGAAATAACACTTGCTGACTTATTCTTGGTACCTCAAGTTCAAGGAGTTGTAGATAGAT
TCCAATTTGATTTAACCCCTTTCCCCAATATTGCAGAAGTTTTAAAAAATTTAAAGGAAA
TTCCTGAGTTCGTTGCTGCCTCACCCAGCAAGTAAGCTGACAATCCTGATAATCAAAAGA
TCTGA