Identifiers and Description

Gene Model Identifier

TTHERM_00571890

Standard Name

None

Aliases

PreTt10519 | 76.m00221 | 3810.m02078

Description

Myb-like DNA-binding domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00571890

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03422.19.997093137033517e-262myb-like DNA-binding domain-co
ntaining protein (811 aa)
OxytrichaContig16439.0.g1051.000159011384939e-43Myb-like DNA-binding domain
DictyBaseDDB_G02939002.9990874792167046e-33mybA on chromosome: 6 position
3493719 to 3497607
Stentor CoeruleusSteCoe_23421.0530617357553812e-20
SGDYKR099W0.00000000019994075865167896BAS1 Myb-related transcription
factor involved in regulating
basal and induced expression
of genes of the purine and his
tidine biosynthesis pathways;
also involved in regulation of
meiotic recombination at spec
ific genes
WormBaseWBGene000083860.000000004999139696582238status:Confirmed UniProt:G5E
FC4 protein_id:CAB00029.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00571890(coding)
ATGTAAAGTGTTAAAAAAGAAAATAATACAAAAATCTAGAGAAAAATAGTTAGTTACCCA
TTTAGTCAAAAAGAAAAGTAATTCATAAAAGAAACAAACAAATAAATACAGAAAGACAGA
CACATATAGAGGAACAAAGAAACAAATACAAGCAGACACTCAAACTAAACAATCATAATA
TATATTAAGATAATTAAATTAAGCATAAACAGAAAATAGTAGATACAGACAAAATCTCAA
TACAAACAAGCAAGCAAGCAAAAAAACAAACAAATTAAAAAAAAACAATAATACAAATTT
TACACTCTCAAAAACATTGATTTATATAGAATCAGAAATATATCAAAAATATTAGCTATC
ATGGTTGATCGCAGAGCATGGAGTGATGATGAAGATAAGGCAATTAGAGACCTAGTGAAT
ACATTTGGTATAAAAAAGTGGACTATAGTTGCCTAAAAAATGGAAGAGTTATATAACTTG
AGTGGTCGTTCAGGAAAGCAGTGTCGTGAAAGATGGCACAATCATTTAGATCCTCATATT
AATAAGTAGCCTTGGACAGAAGAAGAAGAAAAAATTATATTTGAAAATCATAAAAAATGC
GGAAATAAATGGGCTGAGATAGCACGTCATTTACCAGGAAGAACTGATAACTCTATAAAG
AACCACTTCTATTCTACATTAAGAAGGTCACTCAGACGTATCAATAAATTACTTGGAGAT
AAAAACAGTACTGCATAAGTTAAGGATATAAAACCTGGGGTCCTTTCAAAGATTTTTATT
CTTGCAGAGAAGGATGTTAATGAAATCAAAGATGAAGATATGAGAAAATTAAGTATAGCG
TGTAAAGGTTTGTAGGATTCCCTTTTAGAGTTTGCAAATCATAAGCCTCTTAAATCAAAC
AAGAAGAATGGCGAGAATAAGAATGTCTTTCAAGAATAGTCCTTCAAAACATTGATTGAG
AAGATTTTAGAATTTAATTCACTATACAAGAAGAAGAGAGAATAAAAGCTCAAGGAAAAA
GAAAAAAAAATTCTTACTAAACGTAGTGGTGGATCTAGTAAAGGCAGAAAGGATGATTAA
AGTGATGACGATTTATTTGATTAGGATGACGATGATGAAAGCTAGGCTGAAGAAGAAAAT
GAAGCTGCAGAAAATAGCAATTCAAATAATACAAATAAAAATCAAGCAAATGATAATGCT
AACAGTAATGCAAAATCAAAATTATAATTGAATGGCGCATCCAAAGAAAAAAGTAGCAAC
TCTCAAAATGGAAAAAGTAGCAAAAAAGAGTAGTAGCTTGATGATATTTTGAAAAGCAAA
ATAAGAAGTGGTGATAAAAATATTTTTAAAATAGTCAATAATAAAAACTAAAAGCAAGAT
TAGCTAAATAGACAAATGGTGATGCCACAACTTTATTCTATCAACCCAGCATAGGCATTA
AACTTCCTTCCAGAATTTATTCTTGACCCTAGTAAATTTTTAAATCCTGCACTTAATTAG
CTGTTTGATTAAGCCATCTTAGCCCAATAACCGTATCTTATGGGTCTTTATTCAGGTGGT
GCTGATATGGAAAACTATTAATCCTTTTTCGAAGATTAAAATTAAGATTTTAATGATCAA
GGATACTAATATGATGGCTTTTAAAATAGAAAGAAAAGTCCATTTACACCTAATGGAAAT
GGAATTCCTAAAAAAGAATTTGAATCAGATTAGAATGATCACCATATTAACTACAGCTTA
CCTTAATCTAGAAGATATGATCACCAACCTTTAGATCCAAATTTTGGCATGCCAAGCTTC
TTAAATTAATAATAACTACTTTTTAATGCAAACGAATCTCCAAATTTCTAAAACATATAA
AGCCCTGGATCGAGCTTTAGGTATTTATACAATCCTTTCCCTTAGACTCCATAATATCAT
ATGAAATAAAATGGTACTGGATTTACCCCAAGAAACAAGATTATTTAAGGAATTGGAAAG
AGCCAATTTGATGAAAGCTAAGCATTTAACAGTAACAATTAGATTAAGAGCTTAAAAAAT
AGTAATAGTAATGAGAGCTAAGATTAGCACTAGAGCAGCTAAAGTTTACATAATAACAGT
AATAGCAAATTTATAAAATCTAATTTTGGTTCCATTACAAAAGATGAGCAATATCTTACA
AAAATAGCAAATGAAGTAAAGAATGAAATCTAGGCTAACGATTAGAAATTCAAAAAGAAA
TAGACTTAAATAATTTAACTAAATAACAATGTGGGAGGTTTGTCAAGCAATAGTTAAAAT
GGTTATAATAATAAGGCTTAGAATAACTCAATTCGTCAAGAATCTAATGGAAATGCAGCT
CATAACTCTAATTCAAATAATAATAATAACAATAATCAGAATACCAATAATGATGAAATG
TGTTTAGACATAGATTTAATCGAAGAAACCTATAATGATGCAAGTAAAATGTATATAGAA
GTATCATCAAACCGTCATAATAAATAACTATTGTTGTCTCCACATTCTCCTTTTGTGATG
CACAAATAGCACTAAAAATATTAAACTAACTAGCATCCTTTAAATCAATAACTTAATGGT
GTTTTCTCCTCCTAGAATTTAAACGGATCAACAAATTAAACTTCAAGCAATAATAGTAAT
TCAAATCAAAATTTTGCCTAAGGTTTTGGAAGCAACATAGCCATGATGACAAGCAACTTA
TCTACAAGGATAGGTAGCAATAACAGCAACAACAATGGAAAAAACAATGAGTAGAATTCT
AGTAACTAAAATTTAAATTCGTTTAATCCTTACCTGTAAATATAATCTTGA


>TTHERM_00571890(protein)
MQSVKKENNTKIQRKIVSYPFSQKEKQFIKETNKQIQKDRHIQRNKETNTSRHSNQTIII
YIKIIKLSINRKQQIQTKSQYKQASKQKNKQIKKKQQYKFYTLKNIDLYRIRNISKILAI
MVDRRAWSDDEDKAIRDLVNTFGIKKWTIVAQKMEELYNLSGRSGKQCRERWHNHLDPHI
NKQPWTEEEEKIIFENHKKCGNKWAEIARHLPGRTDNSIKNHFYSTLRRSLRRINKLLGD
KNSTAQVKDIKPGVLSKIFILAEKDVNEIKDEDMRKLSIACKGLQDSLLEFANHKPLKSN
KKNGENKNVFQEQSFKTLIEKILEFNSLYKKKREQKLKEKEKKILTKRSGGSSKGRKDDQ
SDDDLFDQDDDDESQAEEENEAAENSNSNNTNKNQANDNANSNAKSKLQLNGASKEKSSN
SQNGKSSKKEQQLDDILKSKIRSGDKNIFKIVNNKNQKQDQLNRQMVMPQLYSINPAQAL
NFLPEFILDPSKFLNPALNQLFDQAILAQQPYLMGLYSGGADMENYQSFFEDQNQDFNDQ
GYQYDGFQNRKKSPFTPNGNGIPKKEFESDQNDHHINYSLPQSRRYDHQPLDPNFGMPSF
LNQQQLLFNANESPNFQNIQSPGSSFRYLYNPFPQTPQYHMKQNGTGFTPRNKIIQGIGK
SQFDESQAFNSNNQIKSLKNSNSNESQDQHQSSQSLHNNSNSKFIKSNFGSITKDEQYLT
KIANEVKNEIQANDQKFKKKQTQIIQLNNNVGGLSSNSQNGYNNKAQNNSIRQESNGNAA
HNSNSNNNNNNNQNTNNDEMCLDIDLIEETYNDASKMYIEVSSNRHNKQLLLSPHSPFVM
HKQHQKYQTNQHPLNQQLNGVFSSQNLNGSTNQTSSNNSNSNQNFAQGFGSNIAMMTSNL
STRIGSNNSNNNGKNNEQNSSNQNLNSFNPYLQIQS


>TTHERM_00571890(gene)
ATGTAAAGTGTTAAAAAAGAAAATAATACAAAAATCTAGAGAAAAATAGTTAGTTACCCA
TGTAAGAAGATTTTTTATAATGTAAAATAAATAAACAAAATTCAATTAATTTTAAGTTAG
TCAAAAAGAAAAGTAATTCATAAAAGAAACAAACAAATAAATACAGAAAGACAGACACAT
ATAGAGGAACAAAGAAACAAATACAAGCAGACACTCAAACTAAACAATCATAATATATAT
TAAGATAATTAAATTAAGCATAAACAGAAAATAGTAGATACAGACAAAATCTCAATACAA
ACAAGCAAGCAAGCAAAAAAACAAACAAATTAAAAAAAAACAATAATACAAATTTTACAC
TCTCAAAAACATTGATTTATATAGAATCAGAAATATATCAAAAATATTAGCTATCATGGT
TGATCGCAGAGCATGGAGTGATGATGTCAGTATTTTTTGATTTCCTTTCATTTATTGAAA
CTAAAATAGAGTTTATTATGTCTGATAGAATTTTAATTTCCCCCAATTTGTTTAGGTTGT
ATTGCTAGGTTTTTGCTACACTTAAATTCAAGTTATCTATTTAGTATTAAATAGTGTAAC
TACAACAAAAAGAAGATTTTCTTCTATAAATTCTAATTTAAGCATTAAGCCTGTTACATT
TAGTCTGAAACCTTACTTAAATATATTCTAAAATATTTAGGAAGATAAGGCAATTAGAGA
CCTAGTGAATACATTTGGTATAAAAAAGTGGACTATAGTTGCCTAAAAAATGGAAGAGTT
ATATAACTTGAGTGGTCGTTCAGGAAAGCAGTGTCGTGAAAGATGGCACAATCATTTAGA
TCCTCATATTAATAAGTAGCCTTGGACAGAAGAAGAAGAAAAAATTATATTTGAAAATCA
TAAAAAATGCGGAAATAAATGGGCTGAGATAGCACGTCATTTACCAGGAAGGTAAGTTTA
TTATAAATAAGCTAATAAATGAAAAAGATTATACTAGATATGTATTAGCTTTTAGAATAC
GTTGTAAATATTAGGTATAACTAATATATTGTTATTAATTAAAAGAACTGATAACTCTAT
AAAGAACCACTTCTATTCTACATTAAGAAGGTCACTCAGACGTATCAATAAATTACTTGG
AGATAAAAACAGTAATTAATTACTTTCATTTTTCATTAGCATATTAATTTTCAAGTTGGC
CTTTCTTTCAATAATTTTTCCTAAATTTTAAAGGTACTGCATAAGTTAAGGATATAAAAC
CTGGGGTCCTTTCAAAGATTTTTATTCTTGCAGAGAAGGATGTTAATGAAATCAAAGATG
AAGATATGAGAAAATTAAGTATAGCGTGTAAAGGTTTGTAGGATTCCCTTTTAGAGTTTG
CAAATCATAAGCCTCTTAAATCAAACAAGAAGAATGGCGAGAATAAGAATGTCTTTCAAG
AATAGTCCTTCAAAACATTGATTGAGAAGATTTTAGAATTTAAGTAATTATAAAATTTAA
ATTTTAACATGAAAAAAAATTGTATAGATAATTTGATAGTATTCGCTCATAAAATATTAA
TAAATCCACTACGATTAATTTTAGTGTTATTGATTGATTGATTCTATATCAAATGAAAAA
TTTTTGATGTAAGATTAAATTAGTAAGTTGTTTTTAAATGGCAGAAAAAAAAATAAACAA
AGAGCTTAGCATAAATCCATAATAGTGAAATGAAGAAATTAACATTATCAATATAAATCT
CCCTGTTAGCTATTTTCATTCAAAATTTCAAATCACATATTGATATTGAGCATATTTTCG
GAAAGAAAAAAAAGAAGATTTTTTGATAATAGAATTTTTAAATTTTAGCTGAACGCATCT
AATTAAGAATGTTTAAAAGCTCATCACACATTATAAACAGAGAGAAAAAAAAGAATATTC
AATTATTATTTTATAGATCTTATTTTACAAATTGTTCATTCAAACTTTAAATATAGAAAT
TCAAATGATGATTGATTATTTTAATTAAAGCGATAAATAGATAATCTCAAAGAATATTAC
TATTAAACAAACACTTTTATAAATTAATCATAAAAAACTAAATAATTTAATGACATTATT
TATTTTAATTATTCATTTAGTAAATTTAAATATTAATAAAATAGTTCACTATACAAGAAG
AAGAGAGAATAAAAGCTCAAGGAAAAAGAAAAAAAAATTCGTAATTATTTAGATTGCATT
TGTTTTAAAAAAAGCATTTTATGTTTTCTTTTGTCTTCTTTTATCAAATTTTAAATAAAT
TATTTCAGGATTTTTTATTTCTGATCAGTTTCTAAAATGTCTGTATTAAAATAATAGTTA
CTAAACGTAGTGGTGGATCTAGTAAAGGCAGAAAGGATGATTAAAGTGATGACGATTTAT
TTGATTAGGATGACGATGATGAAAGCTAGGCTGAAGAAGAAAATGAAGCTGCAGAAAATA
GCAATTCAAATAATACAAATAAAAATCAAGCAAATGATAATGCTAACAGTAATGCAAAAT
CAAAATTATAATTGAATGGCGCATCCAAAGAAAAAAGTAGCAACTCTCAAAATGGAAAAA
GTAGCAAAAAAGAGTAGTAGCTTGATGATATTTTGAAAAGCAAAATAAGAAGTGGTGATA
AAAATATTTTTAAAATAGTCAATAATAAAAACTAAAAGCAAGATTAGCTAAATAGACAAA
TGGTGATGCCACAACTTTATTCTATCAACCCAGCATAGGCATTAAACTTCCTTCCAGAAT
TTATTCTTGACCCTGTAATAACTTATTTTATATTAAATTATTTCTTAAAAAAAGTATTAT
TTGCTATCTTAAAAATTTTATAGTAATTAGTAAAATATTAAAAAATTTCTATATTTTTAA
ATAATAACAGAGTAAATTTTTAAATCCTGCACTTAATTAGCTGTTTGATTAAGCCATCTT
AGCCCAATAACCGTATCTTATGGGTCTTTATTCAGGTGGTGCTGATATGGAAAACTATTA
ATCCTTTTTCGAAGATTAAAATTAAGATTTTAATGATCAAGGATACTAATATGATGGCTT
TTAAAATAGAAAGAAAAGTCCATTTACACCTAATGGAAATGGAATTCCTAAAAAAGAATT
TGAATCAGATTAGAATGATCACCATATTAACTACAGCTTACCTTAATCTAGAAGATATGA
TCACCAACCTTTAGATCCAAATTTTGGCATGCCAAGCTTCTTAAATTAATGTAAGCAAAC
TATCAATCAAACATTTTTCAAATAATTTTAATAAGCTCTTAACTAAATAAAAATAAATAT
TTTAAAATTCAGTCTTAAATAAATTTTTTGATCTACTTCATAAAAAAGAATTAAATTATT
CTTTTATTGATTTTGTTTTATTGACTAAAATATTTTTAACCATTTATTTTAAACTATCAT
AATAGAATAACTACTTTTTAATGCAAACGAATCTCCAAATTTCTAAAACATATAAAGCCC
TGGATCGAGCTTTAGGTATTTATACAATCCTTTCCCTTAGACTCCATAATATCATATGAA
ATAAAATGGTACTGGATTTACCCCAAGAAACAAGATTATTTAAGGAATTGGAAAGAGCCA
ATTTGATGAAAGCTAAGCATTTAACAGTAACAATTAGATTAAGAGCTTAAAAAATAGTAA
TAGTAATGAGAGCTAAGATTAGCACTAGAGCAGCTAAAGTTTACATAATAACAGTAATAG
CAAATTTATAAAATCTAATTTTGGTTCCATTACAAAAGATGAGCAATATCTTACAAAAAT
AGCAAATGAAGTAAAGAATGAAATCTAGGCTAACGATTAGAAATTCAAAAAGAAATAGAC
TTAAATAATTTAACTAAATAACAATGTGGGAGGTTTGTCAAGCAATAGTTAAAATGGTTA
TAATAATAAGGCTTAGAATAACTCAATTCGTCAAGAATCTAATGGAAATGCAGCTCATAA
CTCTAATTCAAATAATAATAATAACAATAATCAGAATACCAATAATGATGAAATGTGTTT
AGACATAGATTTAATCGAAGAAACCTATAATGATGCAAGTAAAATGTATATAGAAGTATC
ATCAAACCGTCATAATAAATAACTATTGTTGTCTCCACATTCTCCTTTTGTGATGCACAA
ATAGCACTAAAAATATTAAACTAACTAGCATCCTTTAAATCAATAACTTAATGGTGTTTT
CTCCTCCTAGAATTTAAACGGATCAACAAATTAAACTTCAAGCAATAATAGTAATTCAAA
TCAAAATTTTGCCTAAGGTTTTGGAAGCAACATAGCCATGATGACAAGCAACTTATCTAC
AAGGATAGGTAGCAATAACAGCAACAACAATGGAAAAAACAATGAGTAGAATTCTAGTAA
CTAAAATTTAAATTCGTTTAATCCTTACCTGTAAATATAATCTTGA