Identifiers and Description

Gene Model Identifier

TTHERM_00566780

Standard Name

ACT4

Aliases

PreTt09018 | 75.m00216 | 3721.m00096

Description

actin

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00566780

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14635.19.997093137033517e-262actin family protein (379 aa)
DictyBaseDDB_G02890051.999126889527329e-167act4 on chromosome: 5 position
2234318 to 2235448
WormBaseWBGene000000645.001363273675253e-167locus:act-2 Actin-2 status
:Confirmed UniProt:P10984
protein_id:CAB04675.1
SGDYFL039C4.9996612394531744e-163ACT1 Actin, structural protein
involved in cell polarization
, endocytosis, and other cytos
keletal functions
OxytrichaContig4562.0.g743.0001680331469735e-143Actin
Stentor CoeruleusSteCoe_322512.138865964899539e-62

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00566780(coding)
ATGGCTGACGACTCTTTAAACCCTGCAATAGTTATTGATAATGGCAGTGGATTTTGTAAA
GTTGGTATTTCTGGCGACGACGCTCCTAGAGTATCAATACCTACAGTTATTGGTATTCCA
AAATAGTAAGGTTTGATGGTTGGTATGGATTAAAAAGATTGCTATATAGGTGAAGAAGTA
AATTCAAAACATGAAGTATTAAACCTTTCCTATCCTATTGATTATGGTGTTATATAAGAA
ATGAAAGATATGGAAAAAATATGGTCACATGCTTCAACTAAAATTAATGCTAACTTTTCA
GGAAGCCCTATTTTAATGACAGAACCTCCATTAAATCCAAAAAAGAAAAGAGAAAAGTTA
ATCGAAGTTATGTTCGAGACATTTAATTGCCATTCATTTTATCTTGCTATATAATAAGTT
TTAGCACTTTTTGCATCTGGACGTACTACTGGTATTGTTGTTGACAGCGGTTATGCTGTT
ACAAGCACTGTTCCTATATATGAAGGATTTGCTCTTAGTCATGCAATATATCAAAATCAC
CTTGCTGGAAGAGATTTAGATGACTATCTTATAAAGTTATTTGAAGAATCAAATAAATAT
TTTTCTAATAATGCTGAAACAAAGAGAGAAAACGCTAGAGATACTAAAGAAAAATGCTGT
TATGTTGTTGGAGATTTCGAAGCTGAAATGAAGAGCTTTAGCGATAAAGGCGATAAAGAA
CCAAAGCATAGAATGCCTGATGGAAATGAAATTTCTCTTGGTAACTAAGTATTTAGATGT
CCTGAAGCACTCTTTTAACCTAGTAAATTGGGTAAAGATAGCTAGGGAATTCACGAAAGC
ACATTCAATTCAATTATGAAATGTGATACTGATATACGTAAAGATTTATATGGTAATATA
GTTATGGCTGGAGGTACAACAATGTTTAAGGGAATTGATGATCGTCTTAATAAAGAAGTT
GTAGCTTTAGCCCCATCTACAATGAGAATCAATGTAATTGCACCTCCCGAAAGAAAATAT
TCAGTCTGGATGGGTGGAAGTATTTTATCCTCTTTATCATCTTTCTAACCTATGTTTATT
ACTCGTTAAGAGTATACAGAATATGGTGCTGCTTACGTTCATAAGAAATGCTTCTGA


>TTHERM_00566780(protein)
MADDSLNPAIVIDNGSGFCKVGISGDDAPRVSIPTVIGIPKQQGLMVGMDQKDCYIGEEV
NSKHEVLNLSYPIDYGVIQEMKDMEKIWSHASTKINANFSGSPILMTEPPLNPKKKREKL
IEVMFETFNCHSFYLAIQQVLALFASGRTTGIVVDSGYAVTSTVPIYEGFALSHAIYQNH
LAGRDLDDYLIKLFEESNKYFSNNAETKRENARDTKEKCCYVVGDFEAEMKSFSDKGDKE
PKHRMPDGNEISLGNQVFRCPEALFQPSKLGKDSQGIHESTFNSIMKCDTDIRKDLYGNI
VMAGGTTMFKGIDDRLNKEVVALAPSTMRINVIAPPERKYSVWMGGSILSSLSSFQPMFI
TRQEYTEYGAAYVHKKCF


>TTHERM_00566780(gene)
ATGGCTGACGACTCTTTAAACCCTGCAATAGTTATTGATAATGGCAGTGGATTTTGTAAA
GTTGGTATTTCTGGCGACGACGCTCCTAGAGTATCAATACCTACAGTTATTGGTATTCCA
AAATAGTAAGGTTTGATGGTTGGTATGGATTAAAAAGATTGCTATATAGGTGAAGAAGTA
AATTCAAAACATGAAGTATTAAACCTTTCCTATCCTATTGATTATGGTGTTATATAAGAA
ATGAAAGATATGGAAAAAATATGGTCACATGCTTCAACTAAAATTAATGCTAACTTTTCA
GGAAGCCCTATTTTAATGACAGAACCTCCATTAAATCCAAAAAAGAAAAGAGAAAAGTTA
ATCGAAGTTATGTTCGAGACATTTAATTGCCATTCATTTTATCTTGCTATATAATAAGTA
AATCTTCATTTTTATTCAAGAAAATATTGCTATCTCCAACTATTTATTCTAAAAAAAATA
AACTTAAAGATTAATTTAAATAATCTTAGTTGCATTAAATATGATATAAAAATAGTTAGT
TTACCTATCAAATTAATCTTCATTAAAATATAGGTTTTAGCACTTTTTGCATCTGGACGT
ACTACTGGTATTGTTGTTGACAGCGGTTATGCTGTTACAAGCACTGTTCCTATATATGAA
GGATTTGCTCTTAGTCATGCAATATATCAAAATCACCTTGCTGGAAGAGATTTAGATGAC
TATCTTATAAAGTTATTTGAAGAATCAAGTAATTAAAATGAATATATTTTAGGGTTTTAT
CCTGCAAAAAATGATATTTATTTATTAATTTATTTCAAATTTTAAAACGTTAATTTAAAT
AATAAAAAGATAAATATTTTTCTAATAATGCTGAAACAAAGAGAGAAAACGCTAGAGATA
CTAAAGAAAAATGCTGTTATGTTGTTGGAGATTTCGAAGCTGAAATGAAGAGCTTTAGCG
ATAAAGGCGATAAAGAACCAAAGCATAGAATGCCTGATGGAAATGAAATTTCTCTTGGTA
ACTAAGTATTTAGATGTCCTGAAGCACTCTTTTAACCTAGTAAATTGGGTAAAGATAGCT
AGGGAATTCACGAAAGCACATTCAATTCAATTATGAAATGTGATACTGATATACGTAAAG
ATTTATATGGTAATATAGTTATGGCTGGAGGTACAACAATGTTTAAGGGAATTGATGATC
GTCTTAATAAAGAAGTTGTAGCTTTAGCCCCATCTACAATGAGAATCAATGTAATTGCAC
CTCCCGAAAGAAAATATTCAGTCTGGATGGGTGGAAGTATTTTATCCTCTTTATCATCTT
TCTAACCTATGTTTATTACTCGTTAAGAGTATACAGAATATGGTGCTGCTTACGTTCATA
AGAAATGCTTCTGA