Identifiers and Description

Gene Model Identifier

TTHERM_00564290

Standard Name

None

Aliases

PreTt08967 | 75.m00165 | 3721.m00047

Description

Endonuclease/Exonuclease/phosphatase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF03372 ) endonuclease/exonuclease/phosphatase family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.2%

TetraMine Data

TTHERM_00564290

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14577.19.997093137033517e-262endonuclease/Exonuclease/phosp
hatase (468 aa)
OxytrichaContig969.1.g366.998542127613979e-20Endonuclease/Exonuclease/phosp
hatase family
SGDYAL021C0.000000000000004001928599951003CCR4 Component of the CCR4-NOT
transcriptional complex, whic
h is involved in regulation of
gene expression; component of
the major cytoplasmic deadeny
lase, which is involved in mRN
A poly(A) tail shortening
WormBaseWBGene000209550.0000000000005000841553255702locus:angl-1 status:Partiall
y_confirmed UniProt:O61903
protein_id:CCD74273.1
DictyBaseDDB_G02894610.00000030014504373857585DDB_G0289461 on chromosome: 5
position 2814027 to 2816075

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00564290(coding)
ATGATGAAAATATATAACAAATTTTCTAAAAAATTGTATACAGCACTCAATTTCAATTTT
TCAGATGAAGTCTCTTGTTCAAAAAGAAAATGGTTACATTTAGGATAAGAAGAAAATGCA
GAGAGCCATTAAAAGAAAGAACTTAGAATAATGTAATACAATGTATTAGCTCCTTGCTAT
ACTTACCCTAATTTGTATCCTGATTGCACAAAACAAGATTTGGAATGGAATGCGAGATTA
GATTTGTTAATAAAAGAAATTAAATTTGTGGATCCTACTATTCTTTGCCTGCAAGAAACT
TAGTTAGATACTCTTTATGATTTAAATGATAAGCTAAGAGAGATTTTTGATGTATCTGTC
ATTCATAGATTAAAAGGAAAATCGAAAAAAGATGGATGTACAACCATTTTTAAGAAAGAA
GAATATGAAGAAATTTATTCAGTAAAACTTGATTTAGATTAATCTAGTAGTATTTATAGC
GAATTATAGTGGATTAACTGTGAAAATATATGCTTATTTACACTTTTAAAAGATAAAAAG
AAACCTAATTCATTTATTTTAATTGGAAACACTCATTTCATATATTCACCTTAAATGGGT
TTAGTTAAGCTGGGATAGGCAAAGCTGATAACATCAGCAATAAAATCTATTTTAGAGGCA
GAAGGTGATAAAAATATTGATGTTTTCTTATGTGGAGATTTCAATTTTATTCCTAACAGT
GCACTTTATTCTTTTTTTACTCAATAAAGCATAAATTTTGAAAGTCTTCCTTTGCATGAG
GTCTCTAACTAAGATATGGCTTATACTTTTGAAAAAAATGAAAACTCAATAGATTAACAC
TTTTAAAGTACAACAAGAAAATATTAATTTTTTAATAAGAATGAAACATAAAAAGAATAT
ATTCCATACTTCCAAACTTTAATGAGTTTAGAAGTAAAGTTTGATAAAAAAAACTAAGAA
TTCAATGTGGTATTTAATAAAAACGAAAATATTAAAAGTAAAAACATAATAACTTCAGAT
ATTTGCTTGAAAAGTGCATATGCTGAAATGTATAAACAATACAATTAAAAATTTCCTAAT
AGCAAAAAAAGTTTAATTAATAATTTGATTTCGAAGATAACTAAAAAGGATAATTTAACT
TATGAGTATGGTTTGTCTCATTTAACCAAAAAAGGATATTTATAATGTGATTTTATATGG
TATAGATTTGCTGAGCCATCTTCCTAAAAACATCTTAAATAAATACTTTAGTAACATGAC
TACTAATATGTAAATAAGTTCAAAGCATTTCCAAATCAATACCATCCTAGTGATCATTTT
CCAATAGTAGCCTCTTTTGAGCTAAATGAATGA


>TTHERM_00564290(protein)
MMKIYNKFSKKLYTALNFNFSDEVSCSKRKWLHLGQEENAESHQKKELRIMQYNVLAPCY
TYPNLYPDCTKQDLEWNARLDLLIKEIKFVDPTILCLQETQLDTLYDLNDKLREIFDVSV
IHRLKGKSKKDGCTTIFKKEEYEEIYSVKLDLDQSSSIYSELQWINCENICLFTLLKDKK
KPNSFILIGNTHFIYSPQMGLVKLGQAKLITSAIKSILEAEGDKNIDVFLCGDFNFIPNS
ALYSFFTQQSINFESLPLHEVSNQDMAYTFEKNENSIDQHFQSTTRKYQFFNKNETQKEY
IPYFQTLMSLEVKFDKKNQEFNVVFNKNENIKSKNIITSDICLKSAYAEMYKQYNQKFPN
SKKSLINNLISKITKKDNLTYEYGLSHLTKKGYLQCDFIWYRFAEPSSQKHLKQILQQHD
YQYVNKFKAFPNQYHPSDHFPIVASFELNE


>TTHERM_00564290(gene)
ATGATGAAAATATATAACAAATTTTCTAAAAAATTGTATACAGCACTCAATTTCAATTTT
TCAGATGAAGTCTCTTGTTCAAAAAGAAAATGGTTACATTTAGGATAAGAAGAAAATGCA
GAGAGCCATTAAAAGAAAGAACTTAGAATAATGTAATACAATGTATTAGCTCCTTGCTAT
ACTTACCCTAATTTGTATCCTGATTGCACAAAACAAGATTTGGAATGGAATGCGAGATTA
GATTTGTTAATAAAGTAAATATTAATGTTTAAAAATTGATTTTAATCAAAATTTACTGTT
AGAAATTACAAGCTTTAATAGTTATTTTTTCCAATATTACCATTTTAAAAAAAAATAATT
ATAATAATAGAGAAATTAAATTTGTGGATCCTACTATTCTTTGCCTGCAAGAAACTTAGT
TAGTAAATAATATTTACATTGGAGATTATAAATTCATTATTATTAACAGTGGGTGATATT
ATTTTTAAATTAATAGGATACTCTTTATGATTTAAATGATAAGCTAAGAGAGATTTTTGA
TGTATCTGTAAATCTTACATGATAACTTGCTATTCATCTAATGAATTAGCTTACTAATTT
AACTAATTTATACTTATTATTATTAAAAGGTCATTCATAGATTAAAAGGAAAATCGAAAA
AAGATGGATGTACAACCATTTTTAAGAAAGAAGAGTATTTATATTTCAATTTGAATTGAT
TTAATTTGAATAAAATTGAACTAGAATTATATTTTAGCTTATTTAATTTTTATCAAACAG
ATATGAAGAAATTTATTCAGTAAAACTTGATTTAGATTAATCTAGTAGTATTTATAGCGA
ATTATAGTGGATTAACTGTGAAAATATATGCTTATTTACACTTTTAAAAGATAAAAAGAA
ACCTAATTCATTTATTTTAATTGGAAACACTCATTTCATATATTCACCTTAAATGGGTTT
AGTTAAGCTGGGATAGGCAAAGCTGATAACATCAGCAATAAAATCTATTTTAGAGGCAGA
AGGTAGAGTTATTTTTGAATTTCCAAATAAAGAAAAAGTATTATTAATTAATTAGGTGAT
AAAAATATTGATGTTTTCTTATGTGGAGATTTCAATTTTATTCCTAACAGTGCACTTTAT
TCTTTTTTTACTCAATAAAGCATAAATTTTGAAAGTCTTCCTTTGCATGAGGTAAATTTT
TTTTTTTCCAATATAATTTAAATTTTATTTATTGATAGGTCTCTAACTAAGATATGGCTT
ATACTTTTGAAAAAAATGAAAACTCAATAGATTAACACTTTTAAAGTACAACAAGAAAAT
ATTAATTTTTTAATAAGAATGAAACATAAAAAGAATATATTCCATACTTCCAAACTTTAA
TGAGTTTAGAAGTAAAGTTTGATAAAAAAAACTAAGAATTCAATGTGGTATTTAATAAAA
ACGAAAATATTAAAAGTAAAAACATAATAACTTCAGATATTTGCTTGAAAAGTGCATATG
CTGAAATGTATAAACAATACAATTAAAAATTTCCTAATAGCAAAAAAAGTTTAATTAATA
ATTTGATTTCGAAGATAACTAAAAAGGATAATTTAACTTATGAGTATGGTTTGTCTCATT
TAACCAAAAAAGGATATTTATAATGTGATTTTATATGGTAAAAAAAATAACATTAAGAAC
AATAATAATAATTAATTGATTTATTTATTATTTATATTTTATTGTAAAAAGGTATAGATT
TGCTGAGCCATCTTCCTAAAAACATCTTAAATAAATACTTTAGTAACATGACTACTAATA
TGTAAATAAGTTCAAAGCATTTCCAAATCAATACCATCCTAGTGATCATTTTCCAATAGT
AGCCTCTTTTGAGCTAAATGAATGA