Identifiers and Description

Gene Model Identifier

TTHERM_00564190

Standard Name

None

Aliases

PreTt08957 | 75.m00155 | 3721.m00037 | TPPT1

Description

Protein-tyrosine phosphatase containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00102 ) Protein-tyrosine phosphatase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00564190

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14569.11.999126889527329e-167protein-tyrosine phosphatase c
ontaining protein (327 aa)
OxytrichaContig11522.0.g891.0002546821282671e-50Protein-tyrosine phosphatase
DictyBaseDDB_G02730971.000159011384939e-43ptpA1-1 on chromosome: 2 posit
ion 2586710 to 2588480
WormBaseWBGene000042135.998886722426197e-42locus:ptp-1 Tyrosine-protein
phosphatase 1 status:Partia
lly_confirmed UniProt:P28191
protein_id:CAB54194.1
Stentor CoeruleusSteCoe_208251.7587922024243116e-25
SGDYDL230W1.9999391735788327e-19PTP1 Phosphotyrosine-specific
protein phosphatase that depho
sphorylates a broad range of s
ubstrates in vivo, including F
pr3p; localized to the cytopla
sm and the mitochondria; propo
sed to be a negative regulator
of filamentation

General Information

Paragraph NoGene NameParagraph Text
119TTHERM_00564190Tetrahymena thermophilia’s TPPT1 protein is homologous with proteins in the Y phosphatase family associated with the removal of phosphate groups from tyrosine residues. It contains 1 domain (E-value= 2.9E-67), which is a Y phosphatase domain. The closest homologs are found in Paramecium tetraurelia, Ichthyopthirius multifiliis, a freshwater fish disease, and Stentor coeruleus, a large ciliate. It is possible that this protein is involved in cell signaling pathways. Paragraph by: Margot Chisholm, Keck Science Center, Pitzer College.

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00564190(coding)
ATGGACACAAAAAATAATTTGTAATAGGAAGAAGCCTTTTATGAAAAATTTGCAGTACCT
CCAGCTCCAATTAAAAAAGAAGAAATTGATTATTCATATACAGAAGAGTTAAAAGCAGAG
ACAAGAAAAATTAAGGATTTGCTGAATTTCAAAATGACTAATTAGTTTTAAGTATTGTAA
ATGATCACTCATACAAATAATCATCATAATAATAGAATCAAAGCAAATGAATTTTTAGAT
TATAATAGATATACTGATATTCTACCATATAAGCATTCAGTTGTTAAAATTAGCGGAAGT
ACCTAAGTTGATTAATACATAAATGCTAATTACATAAATAATCCCTTTAAAGATAAAGCT
TATATTGCTACTCAAGGACCTATTCCAAATACAATCTCTTCTTTTTGGAGAATGATATGG
GAATAAAAAACAAATTTGATTATTATGCTTTGCAAGGAATTCGAATAAAATAAAGTTAAA
TGTGATAAATATTGGCCAAGCCAAGGATAGATCTTATAGGAGGGAGATTTGCAAGTCCAA
TTTTTATCGTAGTAAAAAAATGCATAATAGAATATTATTGAAAGACAATTCATACTCAAG
TATAAAAATGAATAACGTTAAGTCTCTTAAGTGCATTGGGAAGGATGGCCAGATCATGGT
GTTCCTGAAAGTAGAGATTATGGAGTTTTAGAAAATTTAGTATAAAGGGTAGTAAATCAA
ATTGAATAGTCCAAGATTCCTGTCGTGCATTGCAGTGCTGGAGTTGGTAGAACTGGTACA
TTGTTAGCCCTCTCTAATATTTACATGACTTTGAAATATCATTAAGTTAAAAAAACTCCT
ATAGACTAAATAGAATTAAACGTCTTAGATATAGTTAGAAGACTTAGAGAGTAAAGAATG
ATCATGGTATAAATGGATAACTAATTAAACTTAGTATATGAAATTACAAAAACTTTTATC
AGAAAAATGTTCAAATTTTGA


>TTHERM_00564190(protein)
MDTKNNLQQEEAFYEKFAVPPAPIKKEEIDYSYTEELKAETRKIKDLLNFKMTNQFQVLQ
MITHTNNHHNNRIKANEFLDYNRYTDILPYKHSVVKISGSTQVDQYINANYINNPFKDKA
YIATQGPIPNTISSFWRMIWEQKTNLIIMLCKEFEQNKVKCDKYWPSQGQILQEGDLQVQ
FLSQQKNAQQNIIERQFILKYKNEQRQVSQVHWEGWPDHGVPESRDYGVLENLVQRVVNQ
IEQSKIPVVHCSAGVGRTGTLLALSNIYMTLKYHQVKKTPIDQIELNVLDIVRRLREQRM
IMVQMDNQLNLVYEITKTFIRKMFKF


>TTHERM_00564190(gene)
ATTTGATAACTAATTTATTCAATAAATAATTAAATTTATAAGATATAAAAAATCAAAAGA
TAACAAGATCATCAAGAAGCTCTAAGTGAAGTAAAAATAGAAATGGACACAAAAAATAAT
TTGTAATAGGAAGAAGCCTTTTATGAAAAATTTGCAGTACCTCCAGCTCCAATTAAAAAA
GAAGAAATTGATTATTCATATACAGAAGAGTTAAAAGCAGAGACAAGAAAAATTAAGGAT
TTGCTGAATTTCAAAATGACTAATTAGTTTTAAGTAAATATTTTAAGAATAGTTTAAATA
AAATAAATTGTTAAAATAAAAATTTATTTCATCAAGGTATTGTAAATGATCACTCATACA
AATAATCATCATAATAATAGAATCAAAGCAAATGAATTTTTAGATTATAATAGATATACT
GATATTCTACCATGTAATTCTAAAAAAAATATAAAATGAAAATTAATCTAAAATTTGTTA
AAATAGATAAGCATTCAGTTGTTAAAATTAGCGGAAGTACCTAAGTTGATTAATACATAA
ATGCTAATTACATAAATGTATAATAATCAATTTTTTATTTTGCGAATTATTGAAGTGTTT
TGATTGTTTTTTATTTTTTGTTTAGAATCCCTTTAAAGATAAAGCTTATATTGCTACTCA
AGGACCTATTCCAAATACAATCTCTTCTTTTTGGAGAATGATATGGGAATAAAAAACAAA
TTTGATTATTATGCTTTGCAAGGAATTCGTAAATAGTTTAAATTGATAATTAACTTTTTT
TAAACTAATCATGTTTTATGAAAACTTAAAATAGGAATAAAATAAAGTAAGTTATATATT
AGTAGATCTTTAACAGCTATATGTTTTCCATGTTTGACATAATACAATTCAGGTTAAATG
TGATAAATATTGGCCAAGCCAAGGATAGATCTTATAGGAGGGAGATTTGCAAGTCCAATT
TTTATCGTAGTAAAAAAATGCATAATAGAATATTATTGAAAGACAATTCATACTCAAGTA
TAAAAATGAATAACGTTAAGTCTCTTAAGTGCATGTATAATTATCATATTCAGGTTACTA
ATAAGTTTCATAAAATACATTTTATTTAAAAAAGTGGGAAGGATGGCCAGATCATGGTGT
TCCTGAAAGTAGAGATTATGGAGTTTTAGAAAATTTAGTATAAAGGGTAGTAAATCAAAT
TGAATAGTCCAAGATTCCTGTCGTGCATTGCAGGTAATATTAGAAAAAAATATAAATAAA
ATTAGATATGTATACATGTATAAAAAGTGCTGGAGTTGGTAGAACTGGTACATTGTTAGC
CCTCTCTAATATTTACATGACTTTGAAATATCATTAAGTTAAAAGTAAGATAGATTATTT
TTTGTAATTTCTATTCATAATAAGTTTACTTTTTATTTAACGCACAGAAACTCCTATAGA
CTAAATAGAATTAAACGTCTTAGATATAGTTAGAAGACTTAGAGAGTAAAGAATGATCAT
GGTATAAATGGATAACTAATTAAACTTAGTATATGAAATTACAAAAACTTTTATCAGAAA
AATGTTCAAATTTTGAGAATCAAAAATAAATAACTTACCTTTGTTAAATAATCTAAATTT
TTGAATTTAATTAAAATATTTAAATTTGACTTTTTCAATAGTTCTTGAGTTAAAATATAT
GTAGTTATTTAATAAGTTAATTACTTAGCTATTTAGTCATTTATTTATTTTACTTATTAA
CTTACTTACTGATTTAGTAGTAGAATGTACTTTTAAATTATAATTTAATATTTTGGGATA