Identifiers and Description

Gene Model Identifier

TTHERM_00560030

Standard Name

None

Aliases

PreTt27864 | 74.m00141 | 3720.m00032

Description

Kelch motif family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF01363 ) FYVE zinc finger
  • ( PF00643 ) B-box zinc finger
  • ( PF01344 ) kelch repeat protein
  • ( PF07646 ) kelch repeat protein
  • ( PF08729 ) Histone promoter control 2 (HPC2)
  • ( PF00097 ) zinc finger, C3HC4 type (RING
  • ( PF04508 ) Viral A-type inclusion protein repeat
  • ( PF07785 ) Protein of unknown function (DUF1623)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.1%

TetraMine Data

TTHERM_00560030

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16173.19.997093137033517e-262kelch domain-containing protei
n family protein (1070 aa)
OxytrichaContig12560.0.g822.0001081030036656e-67Kelch motif
WormBaseWBGene000021852.0009605191578312e-25locus:kel-3 status:Partially
_confirmed UniProt:O18147
protein_id:CAB04878.2
Stentor CoeruleusSteCoe_283792.6102790696677047e-23
DictyBaseDDB_G02715006.001122775063233e-17keaA on chromosome: 2 position
608312 to 611935

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00560030(coding)
ATGGAATGTGTAAACTGTAATGAAGGATTCAATATGATAAATAGAATTCCTAGGCTTTTA
ACAAATTGTGGGCATTCTATTTGCGAAACTTGTTTAATGTAGTTTTGGAATCATTAAGAA
TATGTTTATATTTGCAAGGCATGCTAAACATCAAACAAGGCTGAGACACTCTCTTTGTTT
CCTAAGAATCTTGCAATATTAAGTCTCACTTAGTTTAATACTTCTGTTAATAATTAAAAT
TTTTACAAGAGTGCAAATGCTAATAATTTTGCATCATAAGATTAGTTTTAGAGGGATTTT
TCTACTCAAAGCATTCACTCAGTAAATCTTAGTCATAATCAATCACTTTAATAGTTTTAT
TAGCCCAACTAATCAATTAATTAGGTGCTACATCACCCAATACAAAATAGTCAAAATATT
GGTAGATTTTCTTTAAATAATCTTACTAACGGAGTGATTAATAATGGTTCTACACCAAAT
TCAAATGGGTAGCTTAAGAGCGTTTAGGTCTAATTAATAGCAGAAAACATATCTGATTTA
AAAAGAGATAATTCAAACAGCAATCTGATTAACTAAAATACTTGTAGCAGCCATTTTAAA
TAATTTGAGGCTTTCTGCTTATAAGATAAATAATTCCTTTGTATATAGTGTATTATCGAT
GCCAACAGCACTCATAAAAATCATAAAATCGAAACTATTGAGAAAGCCGTTCAAATGGAA
GTGCAAGAATTATTAAACTTTTAGATGTTTATTGAAAATAAAAAGAAAGAAAATGTTGAA
AATCTTTAAAAAATAGAGTCCATTAAACAAGAAATTTTAGTGCAAGAGCAAAAATATGCA
GGAATTATTGTTCAATTTTATAATTAAATATTTTAGCTTATAAAAGAAAGATAATAGACT
TATTTAGATAAGCTCTAGTCAGAAAAGCAATTGAAATTGCAGTCACTTGATGATTTGAGA
TAAAATATTATTGATTTTATTCAAAAAATTAATGATTATACTACTGCTAAACAAAAATTT
GATGACTAATCAAGCTCTTTTCCATAAAAGTAATACTTAGTTAAGGTAAAAGAAATACAT
GCTTTGAAAGCAAATATTTCTCAAGGTGTAGATTAGTTAGAAACCTTCAAGAAGAACTCT
AAATTTTTAAATTCTTAATAAACATGTTTAGGGTTTGAATTTAACAGATAGTAAGAAATA
CAAGCAATAAATAAAATTATAGATTAAAACCAAACATAATAAGAAGCTAGTACGCCAAAT
AATAGTAAAGGATTAACAATCAGTCTCTCAAAAGAGAGAATTCTATAGAATCAAAGTAAT
AGCAGTGGTAGCAGTAATGGTAAAAAAAAGAATAACTAACAAAGTAACAGTGGATAAATA
AATTTATCAAATTCTTCTTCTTCCAATTTATAAAAGAAAGGTTTTTACAATAATGTTTCA
ATAAAAAATTAAAAAAGTCACATGAATGAAAGCTATAATAATACAAGTTTATAGCATGAA
ATATCTTTAAATATCTAAGAAAAAGAAAAAGATAACATTACCCTTTAATTGTAATAGCCA
CAATAAAGGAAACACTCCAAAACGCTTTAAGCAACAACTCTAAATTAACTTATTTAACCT
AGTACCGCATCAAACTAAAATAACTTCAACCCTTATTTAATTAATAACAACACAAGCACT
TAAAATAGCTAACCTTAGAACAACTAAATAGATTTTTCAAAATACAAAATAGAAATTACA
AATATCAAGATGGTAAACAGGCAAGCTTCTTAGCCTAAAAAATAGAGCTAAGCAGTAGAT
ATCCCTATGTTTAAAAAAGAAAATATTAACACATTAAATATTATAACAAATCAATAAAAT
GATAAATAAGCTAAGGAAACACTTTATTTAGAAAATAGGAGCAATAAAAACTTGCTAAGC
AGCAAAAATTCTAGCACAAACCATAGTACTAAAAATGTCAATACTCTGAAATATAAATCT
CTTAGAAGTTAAAACCCTTATAATATTTAAACCACTGCATCTACCCTTAGTAACACGTAA
GTCAACGAAAGAGGTAATAGCAGCAGCTCCATAGATAAAATGAAGGTTTTAAGAGGCTCA
ACTACAGAAACAGTAAAAAATGCTGCTAGGCATACAACCTCAGTAACTAACTAATTTGTT
TCTAAGCCCACTCCCCTCACAAATATTACAACTGATGGATATAGCACTAATATTTATAAT
GAAAAAGATCTACAGACTAATAGGACAATTGACAGCAACAAAAATATAGATTTTGATTCA
GAAAGAAACATAATTGATACTGTTAAAATTGATTTTAGTAGCTTAGCTAGCTAAAAAAGA
CAGTTCATCTTAACTATTGGTGGATTTACTGAAAAGTAGTAACATTCTTTATGTATGGAG
AAGCTTGATCTCTAAAATACTTAATGGGAACCTTTTATAACATAAAACAACTTTAAGTCA
AGAGTTAAATTCGGATCAATCATTTACAAGTAAAAGAAAGTCATCATATTTGGAGGTAAG
TAAGAAGGCAAAAGGCTAGATACCTTTGAAGAAATAGATACTTAAACAAAAGAAGCTAAA
ATATTCCCAGGCATAAGACTCTCTAAGCCTAAGAGCGGCTTTGCTTTTACCCAAATTTCA
GATGAGGAAATTATAGTTATTGGAGGCAATGATGGACAGAATATCTTGAGTGATGCAGAA
ATATATAACTTGAATACAAAACAGGTCAGGAAACTTTAACCTCTTTCTTTTGCAAGGGAT
GAATTGGCTGTAGCTTTAAGCAATGACAAAAAATATATATATGCTTTTGGAGGATATAGC
CAGAGCTTAAAGAATTCATTAAATGTTGTGGAAAAGTATGATATCTAAAAAAATAAATGG
GAAACTGTAAAGCCGATGAATCAATGTAGACGTTCACTTCAAGTAGTAACTTTACCAGAT
GGCTTTTATATATTAGGTGGCTTTGATGGATAAAACTACCTAAGTAGTGTAGAAAAATAT
GATGATGCTAATGATTAATGGATTTAAGTTTAAAATATGCTAATGCCCAGAGCTACATTC
TCAGCTCTAAAAAGTCCAGATAACATGGGAATCATAGTCTTAGGAGGCTTTAACAATCAA
CCAATTTAATTATGCGAAAAGTATTCAATATTTAAAGGAGCATGGGAACCTTTTCCAAGT
CTTAACTAAAAAAGATTCATGCATAGCTCAATAATATTTGGAAACAATAGCAGCATGTAT
TACTGA


>TTHERM_00560030(protein)
MECVNCNEGFNMINRIPRLLTNCGHSICETCLMQFWNHQEYVYICKACQTSNKAETLSLF
PKNLAILSLTQFNTSVNNQNFYKSANANNFASQDQFQRDFSTQSIHSVNLSHNQSLQQFY
QPNQSINQVLHHPIQNSQNIGRFSLNNLTNGVINNGSTPNSNGQLKSVQVQLIAENISDL
KRDNSNSNLINQNTCSSHFKQFEAFCLQDKQFLCIQCIIDANSTHKNHKIETIEKAVQME
VQELLNFQMFIENKKKENVENLQKIESIKQEILVQEQKYAGIIVQFYNQIFQLIKERQQT
YLDKLQSEKQLKLQSLDDLRQNIIDFIQKINDYTTAKQKFDDQSSSFPQKQYLVKVKEIH
ALKANISQGVDQLETFKKNSKFLNSQQTCLGFEFNRQQEIQAINKIIDQNQTQQEASTPN
NSKGLTISLSKERILQNQSNSSGSSNGKKKNNQQSNSGQINLSNSSSSNLQKKGFYNNVS
IKNQKSHMNESYNNTSLQHEISLNIQEKEKDNITLQLQQPQQRKHSKTLQATTLNQLIQP
STASNQNNFNPYLINNNTSTQNSQPQNNQIDFSKYKIEITNIKMVNRQASQPKKQSQAVD
IPMFKKENINTLNIITNQQNDKQAKETLYLENRSNKNLLSSKNSSTNHSTKNVNTLKYKS
LRSQNPYNIQTTASTLSNTQVNERGNSSSSIDKMKVLRGSTTETVKNAARHTTSVTNQFV
SKPTPLTNITTDGYSTNIYNEKDLQTNRTIDSNKNIDFDSERNIIDTVKIDFSSLASQKR
QFILTIGGFTEKQQHSLCMEKLDLQNTQWEPFITQNNFKSRVKFGSIIYKQKKVIIFGGK
QEGKRLDTFEEIDTQTKEAKIFPGIRLSKPKSGFAFTQISDEEIIVIGGNDGQNILSDAE
IYNLNTKQVRKLQPLSFARDELAVALSNDKKYIYAFGGYSQSLKNSLNVVEKYDIQKNKW
ETVKPMNQCRRSLQVVTLPDGFYILGGFDGQNYLSSVEKYDDANDQWIQVQNMLMPRATF
SALKSPDNMGIIVLGGFNNQPIQLCEKYSIFKGAWEPFPSLNQKRFMHSSIIFGNNSSMY
Y


>TTHERM_00560030(gene)
ATGGAATGTGTAAACTGTAATGAAGGATTCAATATGATAAATAGAATTCCTAGGCTTTTA
ACAAATTGTGGGCATTCTATTTGCGAAACTTGTTTAATGTAGTTTTGGAATCATTAAGAA
TATGTTTATATTTGCAAGGCATGCTAAACATCAAACAAGGCTGAGACACTCTCTTTGTTT
CCTAAGAATCTTGCAATATTAAGTCTCACTTAGTTTAATACTTCTGTTAATAATTAAAAT
TTTTACAAGAGTGCAAATGCTAATAATTTTGCATCATAAGATTAGTTTTAGAGGGATTTT
TCTACTCAAAGCATTCACTCAGTAAATCTTAGTCATAATCAATCACTTTAATAGTTTTAT
TAGCCCAACTAATCAATTAATTAGGTGCTACATCACCCAATACAAAATAGTCAAAATATT
GGTAGATTTTCTTTAAATAATCTTACTAACGGAGTGATTAATAATGGTTCTACACCAAAT
TCAAATGGGTAGCTTAAGAGCGTTTAGGTCTAATTAATAGCAGAAAACATATCTGATTTA
AAAAGAGATAATTCAAACAGCAATCTGATTAACTAAAATACTTGTAGCAGCCATTTTAAA
TAATTTGAGGCTTTCTGCTTATAAGATAAATAATTCCTTTGTATATAGTGTATTATCGAT
GCCAACAGCACTCATAAAAATCATAAAATCGAAACTATTGAGAAAGCCGTTCAAATGGAA
GTGCAAGAATTATTAAACTTTTAGATGTTTATTGAAAATAAAAAGAAAGAAAATGTTGAA
AATCTTTAAAAAATAGAGTCCATTAAACAAGAAATTTTAGTGCAAGAGCAAAAATATGCA
GGAATTATTGTTCAATTTTATAATTAAATATTTTAGCTTATAAAAGTAATTCTTTAATAA
AATGAAATTTTAACTTTAAAATATTATTTTATATTAAATAAAAGGAAAGATAATAGACTT
ATTTAGATAAGCTCTAGTCAGAAAAGCAATTGAAATTGCAGTCACTTGATGATTTGAGAT
AAAATATTATTGATTTTATTCAAAAAATTAATGATTATACTACTGCTAAACAAAAATTTG
ATGACTAATCAAGCTCTTTTCCATAAAAGTAATACTTAGTTAAGGTAAAAGAAATACATG
CTTTGAAAGCAAATATTTCTCAAGGTGTAGATTAGTTAGAAACCTTCAAGAAGAACTCTA
AATTTTTAAATTCTTAATAAACATGTTTAGGGTTTGAATTTAACAGATAGTAAGAAATAC
AAGCAATAAATAAAATTATAGATTAAAACCAAACATAATAAGAAGCTAGTACGCCAAATA
ATAGTAAAGGATTAACAATCAGTCTCTCAAAAGAGAGAATTCTATAGAATCAAAGTAATA
GCAGTGGTAGCAGTAATGGTAAAAAAAAGAATAACTAACAAAGTAACAGTGGATAAATAA
ATTTATCAAATTCTTCTTCTTCCAATTTATAAAAGAAAGGTTTTTACAATAATGTTTCAA
TAAAAAATTAAAAAAGTCACATGAATGAAAGCTATAATAATACAAGTTTATAGCATGAAA
TATCTTTAAATATCTAAGAAAAAGAAAAAGATAACATTACCCTTTAATTGTAATAGCCAC
AATAAAGGAAACACTCCAAAACGCTTTAAGCAACAACTCTAAATTAACTTATTTAACCTA
GTACCGCATCAAACTAAAATAACTTCAACCCTTATTTAATTAATAACAACACAAGCACTT
AAAATAGCTAACCTTAGAACAACTAAATAGATTTTTCAAAATACAAAATAGAAATTACAA
ATATCAAGATGGTAAACAGGCAAGCTTCTTAGCCTAAAAAGTAAAAAAATTAAAGCTTTT
AGCTGATTATTTAATTTATATTTATTTTTTTTTAATTTAGATAGAGCTAAGCAGTAGATA
TCCCTATGTTTAAAAAAGAAAATATTAACACATTAAATATTATAACAAATCAATAAAATG
ATAAATAAGCTAAGGAAACACTTTATTTAGAAAATAGGAGCAATAAAAACTTGCTAAGCA
GCAAAAATTCTAGCACAAACCATAGTACTAAAAATGTCAATACTCTGAAATATAAATCTC
TTAGAAGTTAAAACCCTTATAATATTTAAACCACTGCATCTACCCTTAGTAACACGTAAG
TCAACGAAAGAGGTAATAGCAGCAGCTCCATAGATAAAATGAAGGTTTTAAGAGGCTCAA
CTACAGAAACAGTAAAAAATGCTGCTAGGCATACAACCTCAGTAACTAACTAATTTGTTT
CTAAGCCCACTCCCCTCACAAATATTACAACTGATGGATATAGCACTAATATTTATAAGT
AATTTAATTTCTTGAAATCAATAATTTTCAATGAAAACAAACACAAATCAAATAATTTTT
TCAATAATAAATTATTTTTTAAAATGTTTTTTTAATAAAAATTTAAAAACAAAAATGAAT
ATTTATAAAAAGTGAAAAAGATCTACAGACTAATAGGACAATTGACAGCAACAAAAATAT
AGATTTTGATTCAGAAAGAAACATAATTGATACTGTTAAAATTGATTTTAGTAGCTTAGC
TAGCTAAAAAAGACAGTTCATCTTAACTATTGGTGGATTTACTGAAAAGTAGTAACATTC
TTTATGTATGGAGAAGCTTGATCTCTAAAATACTTAATGGGAACCTTTTATAACATAAAA
CAACTTTAAGTCAAGAGTTAAATTCGGATCAATCATTTACAAGTAAAAGAAAGTCATCAT
ATTTGGAGGTAAGTAAGAAGGCAAAAGGCTAGATACCTTTGAAGAAATAGATACTTAAAC
AAAAGAAGCTAAAATATTCCCAGGCATAAGACTCTCTAAGCCTAAGAGCGGCTTTGCTTT
TACCCAAATTTCAGGTAAATAGACTAATTTAAGTAAATAAATTAAGGAAGTTTTTTTTAG
ATGAGGAAATTATAGTTATTGGAGGCAATGATGGACAGAATATCTTGAGTGATGCAGAAA
TATATAACTTGAATACAAAACAGGTCAGGAAACTTTAACCTCTTTCTTTTGCAAGGGATG
AATTGGCTGTAGCTTTAAGCAATGACAAAAAATATATATATGCTTTTGGAGGATATAGCC
AGAGCTTAAAGTAATTTAGAAAAATAAAAAAAATAAATATCATTTTTACTAAAAGATTTT
ATTTATTATGATTAAGGAATTCATTAAATGTTGTGGAAAAGTATGATATCTAAAAAAATA
AATGGGAAACTGTAAAGCCGATGAATCAATGTAGACGTTCACTTCAAGTAGTAACTTTAC
CAGATGGCTTTTATATATTAGGTGGCTTTGATGGATAAAACTACCTAAGTAGTGTAGAAA
AATATGATGATGCTAATGATTAATGGATTTAAGTTTAAAATATGCTAATGCCCAGAGCTA
CATTCTCAGCTCTAAAAAGTCCAGATAACATGGGAATCATAGTCTTAGGAGGCTTTAACA
ATCAACCAATTTAATTATGCGAAAAGTAATACATACATTTGTCAATATTTTCTTATAGTA
AAAACATATTATTTAATAGGTATTCAATATTTAAAGGAGCATGGGAACCTTTTCCAAGTC
TTAACTAAAAAAGATTCATGCATAGCTCAATAATATTTGGAAACAATAGCAGCATGTATT
ACTGA