Identifiers and Description

Gene Model Identifier

TTHERM_00558590

Standard Name

None

Aliases

PreTt07955 | 73.m00199 | 3735.m00093

Description

TRNA binding domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF01588 ) tRNA binding domain protein
  • ( TIGR02222 ) export-related chaperone CsaA
  • ( TIGR00399 ) methionyl-tRNA synthetase, beta subunit

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13%

TetraMine Data

TTHERM_00558590

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14429.11.9994671418645758e-169TRNA binding domain-containing
protein (264 aa)
OxytrichaContig15114.0.g234.001202823045957e-54Putative tRNA binding domain
DictyBaseDDB_G02919267.996378988338516e-41DDB_G0291926 on chromosome: 6
position 959253 to 960582
WormBaseWBGene000034152.0008113830639685e-30locus:mars-1 status:Confirme
d UniProt:D3YT56 protein_i
d:CBK19453.1
SGDYGL105W3.999672240330216e-26ARC1 Protein that binds tRNA a
nd methionyl- and glutamyl-tRN
A synthetases (Mes1p and Gus1p
), delivering tRNA to them, st
imulating catalysis, and ensur
ing their localization to the
cytoplasm; also binds quadrupl
ex nucleic acids
Stentor CoeruleusSteCoe_206873.532628572200807e-24

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00558590(coding)
ATGGCACAAAGAAAGGTTTTCTCTCATTTTTTGAATACAATCACAAAACTAGACAATTTA
ATCCATCGTCTTGAAACAAACGTCGGAAAAGTTCACTCAGTTTCACCCTTCTCATAAATT
TTAGATATAAAATAATAAACAGAAGAATAAAACACTTCAAGCAAAATCACCACTCCAGAA
ATTAATTAAGCAAAACCTGCAATGGACACCAAGCCTGTTGAAAATAAACCCGAAGAAGAA
AAGCCTAAGGTTGAAGCCAAGAAGTCTGAACTTAAGCCTCCCACTGATGCTGACTTCTAA
CAAGTTGACATTAGAGTTGGTAAGATCGTTGAATGCTGGAAGCATCCCGAAAGTGAAAAC
TTATACTGCGAAAAGATCGATATTGGTACCGAAGTTAGATAAATCGCTTCTGGATTATAA
AAGTTTGTTCCTATTGAAAATATGAGTGGATTAGTTCTCGTTATGGCCAACCTTAAGGCT
AGAAAGATTGCAGGATTTGAATCTAATGGTATGGTTCTCTGTGCTTCCAACCCTGAACAC
ACCTAAGTTGAACTCTTGAGACCTCCTGCTGATGCTAAGGTTGGTGAAAGAGTTTTCTTA
GAAGGACAACTTGAAAAGTTCCCTCAAGAAATGTAACCCGTCCTTAATCCCAAGAAGAAG
ATTTTTGAAACTGTTGTTCCTGGATTAAAGACCGATGCAGAACTTAATGCTACCTTTGAA
GGAAAGAAGTGGATGACCAGTGCAGGTCTCATTAAGGCTCAATCCCTTGCTAATTGCCAT
ATCTCTTGA


>TTHERM_00558590(protein)
MAQRKVFSHFLNTITKLDNLIHRLETNVGKVHSVSPFSQILDIKQQTEEQNTSSKITTPE
INQAKPAMDTKPVENKPEEEKPKVEAKKSELKPPTDADFQQVDIRVGKIVECWKHPESEN
LYCEKIDIGTEVRQIASGLQKFVPIENMSGLVLVMANLKARKIAGFESNGMVLCASNPEH
TQVELLRPPADAKVGERVFLEGQLEKFPQEMQPVLNPKKKIFETVVPGLKTDAELNATFE
GKKWMTSAGLIKAQSLANCHIS


>TTHERM_00558590(gene)
ATGGCACAAAGAAAGGTTTTCTCTCATTTTTTGAATACAATCACAAAACTAGACAATTTA
ATCCATCGTCTTGAAACAAACGTCGGAAAAGTTCACTCAGTTTCACCCTTCTCATAAATT
TTAGATATAAAATAATAAACAGAAGAATAAAACACTTCAAGCAAAATCACCACTCCAGAA
ATTAATTAAGCAAAACCTGCAATGGACACCAAGCCTGTTGAAAATAAACCCGAAGAAGAA
AAGCCTAAGGTTGAAGCCAAGAAGTCTGAACTTAAGCCTCCCACTGATGCTGACTTCTAA
CAAGTTGACATTAGAGTTGGTAAGATCGTTGAATGCTGGAAGGTAAATTATTATTTTGAT
TGATAATTATGCTAAAGCAAGACAAAAAAAGGCAGAATTTTAAATATAAAATAATATGGA
TTAGTAGATTAAATTTTAAAGAAGAGAATAATTTTAATTAGCAATATTGAAATACAAATT
GATTTAAAATAAATGATATTATTTTGTTTTAAATTATTTTATTTTATATTAGCATCCCGA
AAGTGAAAACTTATACTGCGAAAAGATCGATATTGGTACCGAAGTTAGATAAATCGCTTC
TGGATTATAAAAGTTTGTTCCTATTGAAAATATGAGTGGATTAGTTCTCGTTATGGCCAA
CCTTAAGGCTAGAAAGATTGCAGGTAAATTTTAAAATTAATTAAATATTTCACTTTATGA
TAGTTTGATCATAAATAAAATGATAAATAATATTGAAAGATTGATTGAAAATATTTTAAT
ATTTAGGATTTGAATCTAATGGTATGGTTCTCTGTGCTTCCAACCCTGAACACACCTAAG
TTGAACTCTTGAGACCTCCTGCTGGTAAAAATATTAGAATTTACGAAAATTAAATAAAAT
ACATTTATTATATATAATTTTAAATAATCTTTTTATAATTTAGATGCTAAGGTTGGTGAA
AGAGTTTTCTTAGAAGGACAACTTGAAAAGTTCCCTCAAGAAATGTAACCCGTCCTTAAT
CCCAAGAAGAAGATTTTTGAAACTGTTGTTCCTGGATTAAAGACCGATGCAGAACTTAAT
GCTACCTTTGAAGGTAAATTTAAAACAAAAAGTAAAAAATTTTTAAAAGAATTCAAAATA
TAGGAAAGAAGTGGATGACCAGTGCAGGTCTCATTAAGGCTCAATCCCTTGCTAATTGCC
ATATCTCTTGA