Identifiers and Description

Gene Model Identifier

TTHERM_00558460

Standard Name

EBP1 (microtubule-binding protein)

Aliases

PreTt07942 | 73.m00186 | 3735.m00080

Description

microtubule-binding protein, putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00558460

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14411.19.997093137033517e-262EB1 protein (504 aa)
OxytrichaContig12034.0.g946.999507172836373e-51EB1-like C-terminal motif
DictyBaseDDB_G02836072.0006622580855403e-35eb1 on chromosome: 4 position
912876 to 914543
WormBaseWBGene000133442.0003218023735366e-33locus:ebp-1 status:Partially
_confirmed UniProt:Q9GRZ1
protein_id:CAC14408.1
SGDYER016W1.000137892321693e-31BIM1 Microtubule-binding prote
in that together with Kar9p ma
kes up the cortical microtubul
e capture site and delays the
exit from mitosis when the spi
ndle is oriented abnormally
Stentor CoeruleusSteCoe_285081.4251640827409352e-21

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00558460(coding)
ATGACTGAAGTTGTAACTACTGCAAATCAAAGCAATTTTTTATCTAGATAAGAAATGCTC
TAATGGATCAATGATAGTTTAAAACTTAATGAGAAGAAGATAGAAAATTTAGGCACTGGA
GCTATTTACTGTCAATTATTTGATTTGGTGTACCCTGGAAAGGTGCAGATGGTAAAGGTT
AACTGGAAAGCAAAGTATGAAAATGAATATGTTTCAAATTTCAAGATTTTATAGTAAGCA
TTTGACAAGATGAGTGTTAATAAGCCCATTGATGTGAATAAGTTAATTAAATGTAAATAC
TAAGATAATCTTGAATTTTTACAGTGGATGAAAAAATATCATGATCAATTTCGTAAAAAT
TAAGATAAGCCTTACGATGCTATAGGTAGAAGAAATGGATAAGTTTTGATTGATAGAGAA
TACCCAAATGATAAAATTCCTACTCATCCTCACTTCTAAGCAATTAAAGAATAAGCAAGC
AATATTTTAGATAACAGTGTGAATCATTCATCAAAGCATAATTTTTCAAGGCATTCTAAT
AAAAAGAGCTAAACTCATTTTGTACCTTCTGATTAAGGAAAGCAAATGAGTCATTCTTGC
TAATCTTCGATATCCAATTTATCTATTGATAATGAATTTAATCACCTAGACGAAGCAGAT
GCAGTTAAACCTTATCCATCTACTAATAAAATATAATCTGACTCTCTAATAGAAAGACTT
AAAGATGAACGAAATTTTTATTTTTCTAAGATACAGAGTATTGATTAAATGCTAGATAAT
ATTTCAGACAAGAATCCAATGACTATTAACGATATTAAAAAATATATTAAAACCATTCTA
TACAGTACATAAGATTAAATTTTAACTATATTGGATGATGGAACTGTAACTTTGGCTGAC
AAATAGCTTAATAACGTATCTATTAATTAATTTGAGTCAATGGAAGGTCTTGAGTAGCTC
AAAAAAGAAATACTCAGTACTGATTAATAAATCAAAAGTAGTGCCAAGAAAAACAAAAAG
AAAAACACAAAAACATATGATAACAATTAAGAAAATAAAAACACACTTTTAGTGCCTTAA
CATTAATAAAGCGAAACATTTTCAAATAGATCAAATTAAGGTTTTAAGACCCCAAAAAGT
AGTAAATACTCTTATGAGCAATCTCTATAGCTTGATGATTTCACCACATCAATAAATTAA
AATTCCAATAATAACTTTATAACATTTAACTAAAACAATAATAAATCTCAGTCAATACAA
TCAAATTTTGCTCATAATAAAAAAGATTCAGAACCATTATATGAAATTTTTATAAATGAA
GAATAAAATTAAAAAAATAAATAAAACGAAAATTTAAAAAACTAATCTCAAAGCTCATAT
GGAGATTTAATAAAAATACAACAAGTATCAGAAATATAATTACCAAATAACGATGTGTTT
GAACTAAATTAAAATCTTCTTGAAAGCTAAGACGAAGACTTACTAGGAAATTTAGAGTGA


>TTHERM_00558460(protein)
MTEVVTTANQSNFLSRQEMLQWINDSLKLNEKKIENLGTGAIYCQLFDLVYPGKVQMVKV
NWKAKYENEYVSNFKILQQAFDKMSVNKPIDVNKLIKCKYQDNLEFLQWMKKYHDQFRKN
QDKPYDAIGRRNGQVLIDREYPNDKIPTHPHFQAIKEQASNILDNSVNHSSKHNFSRHSN
KKSQTHFVPSDQGKQMSHSCQSSISNLSIDNEFNHLDEADAVKPYPSTNKIQSDSLIERL
KDERNFYFSKIQSIDQMLDNISDKNPMTINDIKKYIKTILYSTQDQILTILDDGTVTLAD
KQLNNVSINQFESMEGLEQLKKEILSTDQQIKSSAKKNKKKNTKTYDNNQENKNTLLVPQ
HQQSETFSNRSNQGFKTPKSSKYSYEQSLQLDDFTTSINQNSNNNFITFNQNNNKSQSIQ
SNFAHNKKDSEPLYEIFINEEQNQKNKQNENLKNQSQSSYGDLIKIQQVSEIQLPNNDVF
ELNQNLLESQDEDLLGNLE


>TTHERM_00558460(gene)
TTCAATTTTTATAAAATCAATTATCAAATATAGAACTATTTAGCGAAATACCAAACTAAA
TAAAAATAGCAATATAACATATTACAAAAAAAGGAAAGGCTTAAACAAAAGGCAATGACT
GAAGTTGTAACTACTGCAAATCAAAGCAATTTTTTATCTAGATAAGAAATGCTCTAATGG
ATCAATGATAGTTTAAAAGTATTAATTTAATTTATAAAGTATTGCTTTAAATCTATTCAT
TTTCAAAAAGCTTAATGAGAAGAAGATAGAAAATTTAGGCACTGGAGCTATTTACTGTCA
ATTATTTGATTTGGTGTACCCTGGAAAGGTGCAGAGTATTGATTGCTTCATTAATACTTG
TTTAATAACATTTTTTTCAAATTTAAAATCAATAGTGGTAAAGGTTAACTGGAAAGCAAA
GTATGAAAATGAATATGTTTCAAATTTCAAGATTTTATAGTAAGCATTTGACAAGATGAG
TGTTAATAAGCCCATTGATGTAAATTACTTATTAAGATAAAACAATTTTATTAAACGAAA
GAACTAATTAGGTGAATAAGTTAATTAAATGTAAATACTAAGATAATCTTGAATTTTTAC
AGTGGATGAAAAAATATCATGATCAATTTCGTAAAAATTAAGATAAGCCTTACGATGCTA
TAGGTAGAAGAAATGGATAAGTTTTGATTGATAGAGAATACCCAAATGATAAAATTCCTA
CTCATCCTCACTTCTAAGCAATTAAAGAATAAGCAAGCAATATTTTAGATAACAGTGTGA
ATCATTCATCAAAGCATAATTTTTCAAGGCATTCTAATAAAAAGAGCTAAACTCATTTTG
TACCTTCTGATTAAGGAAAGCAAATGAGTCATTCTTGCTAATCTTCGATATCCAATTTAT
CTATTGATAATGAATTTAATCACCTAGACGAAGCAGATGCAGTTAAACCTTATCCATCTA
CTAATAAAATATAATCTGACTCTCTAATAGAAAGACTTAAAGATGAACGAAATTTTTATT
TTTCTAAGATACAGAGTATTGATTAAATGCTAGATAATATTTCAGACAAGAATCCAATGA
CTATTAACGATATTAAAAAATATATTAAAACCATTCTATACAGTACATAAGATTAAATTT
TAACTATATTGGATGATGGAACTGTAACTTTGGCTGACAAATAGCTTAATAACGTATCTA
TTAATTAATTTGAGTCAATGGAAGGTCTTGAGTAGCTCAAAAAAGAAATACTCAGTACTG
ATTAATAAATCAAAAGTAGTGCCAAGAAAAACAAAAAGAAAAACACAAAAACATATGATA
ACAATTAAGAAAATAAAAACACACTTTTAGTGCCTTAACATTAATAAAGCGAAACATTTT
CAAATAGATCAAATTAAGGTTTTAAGACCCCAAAAAGTAGTAAATACTCTTATGAGCAAT
CTCTATAGCTTGATGATTTCACCACATCAATAAATTAAAATTCCAATAATAACTTTATAA
CATTTAACTAAAACAATAATAAATCTCAGTCAATACAATCAAATTTTGCTCATAATAAAA
AAGATTCAGAACCATTATATGAAATTTTTATAAATGAAGAATAAAATTAAAAAAATAAAT
AAAACGAAAATTTAAAAAACTAATCTCAAAGCTCATATGGAGATTTAATAAAAATACAAC
AAGTATCAGAAATATAATTACCAAATAACGATGTGTTTGAACTAAATTAAAATCTTCTTG
AAAGCTAAGACGAAGACTTACTAGGAAATTTAGAGTGA