Identifiers and Description

Gene Model Identifier

TTHERM_00558230

Standard Name

None

Aliases

PreTt07920 | 73.m00164 | 3735.m00058

Description

ABC transporter family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF08426 ) ICE2
  • ( PF01926 ) GTPase of unknown function
  • ( TIGR01978 ) FeS assembly ATPase SufC
  • ( TIGR00955 ) pigment precursor permease
  • ( TIGR01194 ) cyclic peptide transporter
  • ( PF02463 ) RecF/RecN/SMC N terminal domain
  • ( TIGR00958 ) antigen peptide transporter 2
  • ( TIGR01842 ) type I secretion system ATPase
  • ( TIGR01846 ) type I secretion system ATPase
  • ( TIGR03375 ) type I secretion system ATPase
  • ( TIGR01288 ) nodulation ABC transporter NodI
  • ( TIGR01193 ) ABC-type bacteriocin transporter
  • ( PF00005 ) ABC transporter, ATP-binding protein
  • ( PF00664 ) ABC transporter transmembrane region
  • ( TIGR01192 ) glucan exporter ATP-binding protein
  • ( TIGR02673 ) cell division ATP-binding protein FtsE
  • ( TIGR02769 ) nickel import ATP-binding protein NikE
  • ( TIGR02770 ) nickel import ATP-binding protein NikD
  • ( TIGR00288 ) conserved hypothetical protein TIGR00288
  • ( PF08552 ) Golgi protein of unknown function
  • ( TIGR02323 ) phosphonate C-P lyase system protein
  • ( TIGR02324 ) phosphonate C-P lyase system protein
  • ( TIGR02857 ) thiol reductant ABC exporter, CydD
  • ( TIGR02868 ) thiol reductant ABC exporter, CydC
  • ( PF01656 ) CobQ/CobB/MinD/ParA nucleotide binding domain
  • ( TIGR01166 ) cobalt ABC transporter, ATP-binding protein
  • ( TIGR01189 ) heme ABC exporter, ATP-binding protein
  • ( TIGR00968 ) sulfate ABC transporter, ATP-binding protein
  • ( TIGR03415 ) choline ABC transporter, ATP-binding protein
  • ( TIGR00954 ) Peroxysomal long chain fatty acyl
  • ( TIGR01277 ) thiamine ABC transporter, ATP-binding protein
  • ( TIGR02204 ) ABC transporter, permease/ATP-binding protein
  • ( TIGR02633 ) D-xylose ABC transporter, ATP-binding protein
  • ( TIGR02982 ) ABC exporter ATP-binding subunit, DevA
  • ( TIGR00957 ) multi drug resistance-associated protein (MRP)
  • ( TIGR00972 ) phosphate ABC transporter, ATP-binding protein
  • ( TIGR01187 ) polyamine ABC transporter, ATP-binding protein
  • ( TIGR02142 ) molybdate ABC transporter, ATP-binding protein
  • ( TIGR03410 ) urea ABC transporter, ATP-binding protein
  • ( TIGR03411 ) urea ABC transporter, ATP-binding protein
  • ( TIGR02203 ) lipid A export permease/ATP-binding protein
  • ( TIGR02315 ) phosphonate ABC transporter, ATP-binding protein
  • ( TIGR03269 ) methyl coenzyme M reductase system,
  • ( TIGR02211 ) lipoprotein releasing system, ATP-binding protein
  • ( TIGR02314 ) D-methionine ABC transporter, ATP-binding protein
  • ( TIGR01184 ) nitrate ABC transporter, ATP-binding proteins
  • ( TIGR01186 ) glycine betaine/L-proline transport ATP binding
  • ( TIGR01271 ) cystic fibrosis transmembrane conductor regulator
  • ( TIGR00960 ) Type II (General) Secretory Pathway
  • ( TIGR01188 ) daunorubicin resistance ABC transporter, ATP-binding
  • ( TIGR03005 ) ectoine/hydroxyectoine ABC transporter, ATP-binding protein
  • ( TIGR03265 ) putative 2-aminoethylphosphonate ABC transporter, ATP-binding
  • ( TIGR03258 ) 2-aminoethylphosphonate ABC transport system, ATP-binding

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00558230

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
WormBaseWBGene000034109.997093137033517e-262locus:mrp-4 status:Partially
_confirmed UniProt:G5EFP3
protein_id:CAB02667.1
Tetrahymena borealisEI9_14382.19.997093137033517e-262ABC transporter (1555 aa)
DictyBaseDDB_G02876919.997093137033517e-262abcC3 on chromosome: 5 positio
n 792495 to 797051
OxytrichaContig250.0.g169.997093137033517e-262ABC transporter
SGDYGR281W9.997093137033517e-262YOR1 Plasma membrane ATP-bindi
ng cassette (ABC) transporter,
multidrug transporter mediate
s export of many different org
anic anions including oligomyc
in; similar to human cystic fi
brosis transmembrane receptor
(CFTR)
Stentor CoeruleusSteCoe_346014.408531331463226e-71

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00558230(coding)
ATGCAGGTTTAATAAGATACAGATGGCGTTAAGCCTCCTATTACTCATATCGCTATCGAA
ATGAAATAGAAGGAATCCATCAATAACAATGTGAATAATGACTAACCTTAAAACCCCTAA
AGCTTACATCATAAGAAATTTTAGTTTACATAGGAAGAATTAATAGCAAAAGGGAAAACA
AAGTATCATGAAAATAATGAGGTTAAAGCTGGATTTTTCTCATTTTTGACATTTTTCTGG
ACTTAAGGAATTATGTCTATGGGTGCAAAGCGTGAAAAGGAAAAGAAGTATTTGCAATAG
GATGACTTGTATGATTGTAGACCAAAAGAGCAGCCTCTTTTCGCATACAATTTTATGGAA
GAGCATTTAATTTAACAAATAAGATCATTAGGAAGATAAGATCTACACGATGAAGCTGAA
CACGTAAAGAAGATGGCTGAAGAAAAACTGTTTAGAAGGTAAAATGGAGAGAAGGGAACC
AAGCAATAAGAAAGACCTTACAAATAAAGAAAAATAGTAGAAAAAGTATTGAAAATTTTA
GGTCTAAAGACATTTATCCTTGCTTGTGTTTTGGCTACAGTAGCTAATTTACTGCAGTTT
TCTGGCCCACTTTTTCTTAATGAAATTCTTAAATACATTTAATCATCTAGCGATGAACCT
AAATGGCATGGATATTTATGGGCAAGTTTACTTACTGTTTGCTATCTACTTAGAACATTC
ATTCTTTAACACTCTTTACACTTGATTAACTTCACTGGTTTGCAAGTTTTAAATGCCTTG
AGCAGTTCGATTTACACAAAAATTATGAGAGTTTCTTCATCCACCAGAAAATATTTTGAC
ACAGGAAAAACTATGAATTTAATTTCAGTTGATTCTCAAGCAGTATTCTAATTAATTATG
TTGGGAACCTTCTTAGTTTCTTCCCCAATCATGGTTGTTGTAAGTATGGCCTTAATTATT
GTATAAATTGGCCCTATTGGTTTAGTTGCTCCTGTTTTCTTTGTTTTTGGAACATATCTT
TAAAAGAAAATTAACGCCGCTGCATTTGCTTTAAGAAAAATGCTACTCACTTTTACAGAT
AAGAGATCTAAATCTGTGAATGAATTTTTTGAAGGAATACGTATAATTAAGTATTACGCA
TGGGAAGACATGGTTAGCGAACGTATCTTCAATATTCGTTAAAATGAATTAAAAGGATTG
ATGAAAAGTTAAATTTTAAAGAGTTTAATAGAAGTCACTATGAATGTTACTCCTCTTTTA
ATGAGTATCCTTATTTTTGGTTTGTATGCAGCTATCTATAGCGATTTCAATGCAGCAAAA
GCATATACAGTTTTGAGTTTATTCAATTTACTACTTATACCTTTGAGAATGGTTACAATG
GTGTTAATGATGTACTTAAATGCAAAGGCTTCTATGACTAGAATCGAATTCTACTTAATG
AGTGAAGAAAGAGAAGAAGATGTTGTAATTAAAGACGACCCATCCTTATAAGTCGGAGAA
ATTGAAATCAATAATGGAAATTTTGCTTGGGAATCAGTAACAGCTGCCATTCACAATGAG
TAAGGCATGAAGTTTATGAGATAAGGTGGTCCACCTGGAGGCTAGAAAAAACCTACACCA
GGCAATAATGAGAAACCTAAAGGCCCTGGTTCATATTAATAAAATGAAACATTAGCTACC
CAAAATGATTAATTGATCCAAAAAGAAGAAGATTTCAATAAACTAACTCCACTTGAAGAG
CTTTCTTTGAAAAATTTGAATATTCTTAAAAACATCAATCTTAAAGTAAAGTCCGGATAA
ATGATGGCTATTGTTGGATAAGTAGCTGCTGGTAAATCCAGCTTACTTCTTGCAATTCTT
GGTGAAATGAAAAAGAACACTGGTGAAGTCAAAGTAAAGGGAAAAATAGCTTACGTTCCT
TAAACAGCTTGGTTATAAAATGCTACTTTGAGAGACAATATACTCTTCGGATAGCCTTGG
GATGAAAAAAAATATAACGATGTTATTGATAGATGTTAATTGAGATCTGAAATAGAAAAT
GGTGAAGTTCTTCCTGGTGGAGATATGACAGAAATCGGTGAAAGAGGTATAAACCTTTCT
GGTGGTTAAAAGTAAAGAGTAGCTATAGCAAGAGCTCTATACTCTGATTCTGACATATTT
ATTATAGACGATTGCTTAAGTGCTCTAGATGCTCATGTCGGAAAGAATGTCTTTGATCTT
GTTTTAAAAGGCGCCCTTAAAAATAAAACAGTTGTTTTTGTTACTCATGCTCTTCATTAT
ATGCCTGAAGTTGAAAGAATCATTGTAATGAAGGAGGGTGAGATCGTTGAAGATGGAACT
CATGAATATTTAAAGAAAAATGGCTAAGAGTATATTAGACTAAATTAATTATAAGAAGAA
AAGAAACAAGAAGAAGAGAAATCATAAAAAGAAAAGAGTAGAATATCTAATAAAGAAGAT
CTAGAAGTTGAAAATGATTAAGAAAATGACGAGAACAAGCTTGCCGAAGAAGAATAATCT
ATGAATCATGATCCAGATTTACCTTCAGCCGAAAGAATAGAGCTAAAAAATAGATAATCA
GAAGTTCTTAGTCAAACAAATAAGGTTAGAAGAAGAACTATGGAATCAAGAAATGAATCC
GAATAATAAAAGAATGAAGAAAATAAATTAGAAATTAAGAAATAAGTTGGTAAAATTGTT
TAAAAAGAAGAAAGAGCTACAGGTGCAGTACCAGGCTATGTATACAAAAAATACATTAAT
TTCTCAGGTCTTAAAAATACCTTGGTTATGATTACATGCTTTTGCTTAGCCCAAGCTTTT
AAAATGGTTTCTGATTGGTGGATTGGTTAATGGAGTTCAGATTCATATGAACTTAAAACT
GGAGCTTATATCGGAATTTATGCTATTTTAATTATATTCTCAGGTCTTTTCATTTTCCTG
AGAGGTTATACATTTGGTATTTTCAGTTTAAAAAGCTCATAAAACTTTTAGCAATCTCTT
CTGAGCAAACTTTTACACACTCCTCTTTGGTGGTTTGATATCACACCAACAGGTAGAATT
GTTGCTAGAACAAGTAAAGATTAGGATGACTTAGATAGTAGTCTACCTTGGAATATGCAA
TTTGCAGTAACTAACATCATATAACTTATTGCTACTTGCATTATGATCGGCATTATTCTT
CCCCTCTTCTTTATTGTTTTCTTTATTACTTTCTTCATATACGTCAGAATTATTGGATAT
TACCTTATCACAGCTAGAGAAATTAAGAGATTAGAAGCCAACACAAGAGCTCCAGTTATC
TCTCATTATTAAGAATCTATCAATGGACTTTATGTTATTAGAGCCTTTGGCAAAGAAAAG
GACTTCATTCAAAAAATGCTTCTAAATGAAAGAGATTATATTATCAGTTTTACAAATATG
AACTACACTAATAGATGGATTTCTATTATTACAGAGATATTTGCTTTAGTCATAATCAGT
GGTACTGCATATTTCGGTGTTTTGAGTAAATAATTCAACTATTAAAGCAATGGTTCTTTG
ATTGGTTTAGCTCTTACATATAGTTTCTAAATTTCAGCTATTTTATCATTTACTCTTAAG
CTTATTGCAGACACTGAAAGTGGCATGAATGCTGTCGTTAGAATGCTTTAATATATTGAA
AAGAACCCACAAGAAAATGACTGGAGATCATAAAAACCTATTGAGAAATGGCCTCAATAA
GGTCAATATTAGCTAGATAAAATCACCTATAAATATAGAGAAGAATTGCCCACAGTTATC
AATGGTATTTCTTTTGACATCAAGAATAATGAAAAAATTGGTGTTGTTGGTAGAACTGGA
AGTGGTAAATCTACTTTGACTTTAGGTTTGATGAGAATTCTTGAACTAATTCAAGACAAT
AATGGATAACTTGGTAAAATTAGTTTAGATGGATAAAATATTAGAGATATTGGATTACAT
GATTTGAGAGAAAAAGTAACTATCATTCCTTAGGATCCTCTATTATTCAGTGGAACAATT
AGATCAAATATCGATCCATATAAAAAATATACTGATTCGGAAATATGTGACGTTCTTTAA
AAAGTGGAGATCTGGAATTAACTTGACTCCATTCTTGAGAAATAGTTAGAAAAAGAAAGT
AAAGAAAAGAAATAAGGTGGCTAACTTTCAAACAATCCTAACTACTAGATGGAGTAAATA
TAGAAGAAAAAATTAGAAATTGTTGTAGAAGGAGGAGGTTCAAACTTTTCTTTAGGACAA
AGACAATTGATATGCATTGCAAGAGCTTTGATTAAAAAACCTAAAGTACTCTTGATGGAT
GAAGCTACTGCCAGTATTGATGAAATGACTGATAGATTAATATAAAATATGATTAAAAAA
GAGCTTACTTAAACCACAGTAGTTACTATTGCACACAGACTGAAAACAATTATTCAATAC
GATAGAATAGTCGTTTTAGAACTTGGTAATTTGAAGGAAATAGAAACTCCATCAACTCTC
TTAGAAAATCCAAACAGCTATTTCTGTAAGCTTGTTAATTCTCATGGCAAATAATTCTAT
GATGAAATGAAATTGCTAGCTAAGAACAAAGAACTTGATGTCTATTGA


>TTHERM_00558230(protein)
MQVQQDTDGVKPPITHIAIEMKQKESINNNVNNDQPQNPQSLHHKKFQFTQEELIAKGKT
KYHENNEVKAGFFSFLTFFWTQGIMSMGAKREKEKKYLQQDDLYDCRPKEQPLFAYNFME
EHLIQQIRSLGRQDLHDEAEHVKKMAEEKLFRRQNGEKGTKQQERPYKQRKIVEKVLKIL
GLKTFILACVLATVANLLQFSGPLFLNEILKYIQSSSDEPKWHGYLWASLLTVCYLLRTF
ILQHSLHLINFTGLQVLNALSSSIYTKIMRVSSSTRKYFDTGKTMNLISVDSQAVFQLIM
LGTFLVSSPIMVVVSMALIIVQIGPIGLVAPVFFVFGTYLQKKINAAAFALRKMLLTFTD
KRSKSVNEFFEGIRIIKYYAWEDMVSERIFNIRQNELKGLMKSQILKSLIEVTMNVTPLL
MSILIFGLYAAIYSDFNAAKAYTVLSLFNLLLIPLRMVTMVLMMYLNAKASMTRIEFYLM
SEEREEDVVIKDDPSLQVGEIEINNGNFAWESVTAAIHNEQGMKFMRQGGPPGGQKKPTP
GNNEKPKGPGSYQQNETLATQNDQLIQKEEDFNKLTPLEELSLKNLNILKNINLKVKSGQ
MMAIVGQVAAGKSSLLLAILGEMKKNTGEVKVKGKIAYVPQTAWLQNATLRDNILFGQPW
DEKKYNDVIDRCQLRSEIENGEVLPGGDMTEIGERGINLSGGQKQRVAIARALYSDSDIF
IIDDCLSALDAHVGKNVFDLVLKGALKNKTVVFVTHALHYMPEVERIIVMKEGEIVEDGT
HEYLKKNGQEYIRLNQLQEEKKQEEEKSQKEKSRISNKEDLEVENDQENDENKLAEEEQS
MNHDPDLPSAERIELKNRQSEVLSQTNKVRRRTMESRNESEQQKNEENKLEIKKQVGKIV
QKEERATGAVPGYVYKKYINFSGLKNTLVMITCFCLAQAFKMVSDWWIGQWSSDSYELKT
GAYIGIYAILIIFSGLFIFLRGYTFGIFSLKSSQNFQQSLLSKLLHTPLWWFDITPTGRI
VARTSKDQDDLDSSLPWNMQFAVTNIIQLIATCIMIGIILPLFFIVFFITFFIYVRIIGY
YLITAREIKRLEANTRAPVISHYQESINGLYVIRAFGKEKDFIQKMLLNERDYIISFTNM
NYTNRWISIITEIFALVIISGTAYFGVLSKQFNYQSNGSLIGLALTYSFQISAILSFTLK
LIADTESGMNAVVRMLQYIEKNPQENDWRSQKPIEKWPQQGQYQLDKITYKYREELPTVI
NGISFDIKNNEKIGVVGRTGSGKSTLTLGLMRILELIQDNNGQLGKISLDGQNIRDIGLH
DLREKVTIIPQDPLLFSGTIRSNIDPYKKYTDSEICDVLQKVEIWNQLDSILEKQLEKES
KEKKQGGQLSNNPNYQMEQIQKKKLEIVVEGGGSNFSLGQRQLICIARALIKKPKVLLMD
EATASIDEMTDRLIQNMIKKELTQTTVVTIAHRLKTIIQYDRIVVLELGNLKEIETPSTL
LENPNSYFCKLVNSHGKQFYDEMKLLAKNKELDVY


>TTHERM_00558230(gene)
ATGCAGGTTTAATAAGATACAGATGGCGTTAAGCCTCCTATTACTCATATCGCTATCGAA
ATGAAATAGAAGGAATCCATCAATAACAATGTGAATAATGACTAACCTTAAAACCCCTAA
AGCTTACATCATAAGAAATTTTAGTTTACATAGGAAGAATTAATAGCAAAAGGGAAAACA
AAGTATCATGAAAATAATGAGGTTAAAGCTGGATTTTTCTCATTTTTGACATTTTTCTGG
ACTTAAGGAATTATGTCTATGGGTGCAAAGCGTGAAAAGGAAAAGAAGTATTTGCAATGT
AAAGAAATTACTTTTTGCATAAAATTATTTATTCATTAAACCGATATAATAATAAAAATA
TAGAGGATGACTTGTATGATTGTAGACCAAAAGAGCAGCCTCTTTTCGCATACAATTTTA
TGGAAGAGCATTTAATTTAACAAATAAGATCATTAGGAAGATAAGATCTACACGATGAAG
CTGAACACGTAAAGAAGATGGCTGAAGAAAAACTGTTTAGAAGGTAAAATGGAGAGAAGG
GAACCAAGCAATAAGAAAGACCTTACAAATAAAGAAAAATAGTAGAAAAAGTATTGAAAA
TTTTAGGTCTAAAGACATTTATCCTTGCTTGTGTTTTGGCTACAGTAGCTAATTTACTGC
AGGTATAATTAAGATTGTTTTAGTCTACTTTCTAAAATTTAAGAATTTACTTGTAAATAT
GTCGCGAAATATTTTCAAAACAAAAAGATATGATCGATATTTGTTTTCCTTAAAAATAAT
AAAAATAATTCCACAATTATTTTTTAGTTATATAAAGAAAAAATTGTTATAGTCAAAATG
ATTGCTTAAATTACTTATTTAACAATTAGTACTTCCTTAATTAATAAAAAAATAGAGGTT
CAAAATAAATTAATTTGATTGGGTTAAGCCTAAATTTTTTTCTTTTAAATTAAATTATAA
TGAATGATTAGAAAATAGAGCAATCGATATTTATTTACCTCTACTTTTAATTTATAAAAT
TTATTTCTTTTATCTAATTAAATTCATTACAATTTACTCTTAATAAATATAGTTTTCTGG
CCCACTTTTTCTTAATGAAATTCTTAAATACATTTAATCATCTAGCGATGAACCTAAATG
GCATGGATATTTATGGGCAAGTTTACTTACTGTTTGCTATCTACTTAGAACATTCATTCT
TTAACACTCTTTACACTTGATTAACTTCACTGGTTTGCAAGTTTTAAATGCCTTGAGCAG
TTCGATTTACACAAAAATTATGAGAGTTTCTTCATCCACCAGAAAATATTTTGACACAGG
TAATAAAAAATTGCCATTTTTTAATTTTCAAATGCAAATTTTCAATTAATAATATTTTAG
GAAAAACTATGAATTTAATTTCAGTTGATTCTCAAGCAGTATTCTAATTAATTATGTTGG
GAACCTTCTTAGTTTCTTCCCCAATCATGGTTGTTGTAAGTATGGCCTTAATTATTGTAT
AAATTGGCCCTATTGGTTTAGTTGCTCCTGTTTTCTTTGTTTTTGGAACATATCTTTAAA
AGAAAATTAACGCCGCTGCATTTGCTTTAAGAAAAATGCTACTCACTTTTACAGATAAGA
GATCTAAATCTGTGAATGAATTTTTTGAAGGAATACGTATAATTAAGGTAAAATATAAAT
CATAATTTTTTATTTCTTTTATTGAATTTGCTTTCATAAAAAATTATTTAAATAATTTCA
AACCAAGCAATTTTACATTCTTTGAAATTAGTTAATTAATTTAAATAAAATTAAACCAAT
AAAAAATTTTGATAAATTAATTAACTATTTTTATAAATATTTCTCAGAAAATTCCTAAAA
TCATAAATTTATTGAATGTCAAATAATTGGCTTTAATAATTTAATTAATTTTAAAACAAT
AAAGTATTACGCATGGGAAGACATGGTTAGCGAACGTATCTTCAATATTCGTTAAAATGA
ATTAAAAGGATTGATGAAAAGTTAAATTTTAAAGAGTTTAATAGAAGTCACTATGAATGT
TACTCCTCTTTTAATGAGTATCCTTATTTTTGGTTTGTATGCAGCTATCTATAGCGATTT
CAATGCAGCAAAAGCATATACAGTTTTGAGTTTATTCAATTTACTACTTATACCTTTGAG
AATGGTTACAATGGTGTTAATGATGTACTTAAATGCAAAGGCTTCTATGACTAGAATCGA
ATTCTACTTAATGAGTGAAGAAAGAGAAGAAGATGTTGTAATTAAAGACGACCCATCCTT
ATAAGTCGGAGAAATTGAAATCAATAATGGAAATTTTGCTTGGGAATCAGTAACAGCTGC
CATTCACAATGAGTAAGGCATGAAGTTTATGAGATAAGGTGGTCCACCTGGAGGCTAGAA
AAAACCTACACCAGGCAATAATGAGAAACCTAAAGGCCCTGGTTCATATTAATAAAATGA
AACATTAGCTACCCAAAATGATTAATTGATCCAAAAAGAAGAAGATTTCAATAAACTAAC
TCCACTTGAAGAGCTTTCTTTGAAAAATTTGAATATTCTTAAAAACATCAATCTTAAAGT
AAAGTCCGGATAAATGATGGCTATTGTTGGATAAGTAGCTGCTGGTAAATCCAGCTTACT
TCTTGCAATTCTTGGTGAAATGAAAAAGAACACTGGTGAAGTCAAAGTAAAGGGAAAAAT
AGCTTACGTTCCTTAAACAGTAATTAAATTTTTCATAATTTGTAATATGTAAATTTTTTT
TTTAAAACTAGGCTTGGTTATAAAATGCTACTTTGAGAGACAATATACTCTTCGGATAGC
CTTGGGATGAAAAAAAATATAACGATGTTATTGATAGATGTTAATTGAGATCTGAAATAG
AAAATGGTGAAGTAATTAATTAATTAATTAATGTTTTATAATTAGCTTATTTTTCATTTT
TTATCTAAACTCAACAATAGGTTCTTCCTGGTGGAGATATGACAGAAATCGGTGAAAGAG
GTATAAACCTTTCTGGTGGTTAAAAGTAAAGAGTAGCTATAGCAAGAGCTCTATACTCTG
ATTCTGACATATTTATTATAGACGATTGCTTAAGTGCTCTAGATGCTCATGTCGGAAAGA
ATGTCTTTGATCTTGTTTTAAAAGGCGCCCTTAAAAATAAAACAGTTGTTTTTGTTACTC
ATGCTCTTCATTATATGCCTGAAGTTGAAAGAAGTAAAATTTAAAATTAATTTACTAATT
TATAAAATCAAAAATTTAATAATTTACTAAATGTTTCTAATTTAACTAACTAATTAATTA
GTCATTGTAATGAAGGAGGGTGAGATCGTTGAAGATGGAACTCATGAATATTTAAAGAAA
AATGGCTAAGAGTATATTAGACTAAATTAATTATAAGAAGAAAAGAAACAAGAAGAAGAG
AAATCATAAAAAGAAAAGAGTAGAATATCTAATAAAGAAGATCTAGAAGTTGAAAATGAT
TAAGAAAATGACGAGAACAAGCTTGCCGAAGAAGAATAATCTATGAATCATGATCCAGAT
TTACCTTCAGGTAATTTAAAATTAATAAACTTAGAATTATCAATATTAATTTTATTTTTT
ATATTTAGCCGAAAGAATAGAGCTAAAAAATAGATAATCAGAAGTTCTTAGTCAAACAAA
TAAGGTTAGAAGAAGAACTATGGAATCAAGAAATGAATCCGAATAATAAAAGAATGAAGA
AAATAAATTAGAAATTAAGAAATAAGTTGGTAAAATTGTTTAAAAAGAAGAAAGAGCTAC
AGGTGCAGTACCAGGCTATGTATACAAAAAATACATTAATTTCTCAGGTCTTAAAAATAC
CTTGGTTATGATTACATGCTTTTGCTTAGCCCAAGCTTTTAAAATGGTTTCTGATTGGTA
AATTTATTTATTTATTCATTCATTCATTCATTTCTCACTAAAATTAAAATATTTTTCAAT
TTCATTTTTATCTAATTAATTAATTTTAGCTTTTGACTTATTTATTTATTTATTTGTACA
ATTTTTAAATAGGTGGATTGGTTAATGGAGTTCAGATTCATATGAACTTAAAACTGGAGC
TTATATCGGAATTTATGCTATTTTAATTATATTCTCAGGTCTTTTCATTTTCCTGAGAGG
TTATACATTTGGTATTTTCAGTTTAAAAAGCTCATAAAACTTTTAGCAATCTCTTCTGAG
CAAACTTTTACACACTCCTCTTTGGTGGTTTGATATCACACCAACAGGTAGAATTGTTGC
TAGAACAAGTAAAGATTAGGATGACTTAGATAGTAGTCTACCTTGGAATATGCAATTTGC
AGTAACTAACATCATATAACTTATTGCTACTTGCATTATGATCGGCATTATTCTTCCCCT
CTTCTTTATTGTTTTCTTTATTACTTTCTTCATATACGTCAGAATTATTGGGTAAATTTA
TTTTCGAAAGCAATTAATTAAATAAACAAACAAAAAAATATTATTAAAAATAAGATATTA
CCTTATCACAGCTAGAGAAATTAAGAGATTAGAAGCCAACACAAGAGCTCCAGTTATCTC
TCATTATTAAGAATCTATCAATGGACTTTATGTTATTAGAGCCTTTGGCAAAGAAAAGGA
CTTCATTCAAAAAATGCTTCTAAAGTAACTTAAAAATTTATTTAGCTTTAAATATATTTA
TTAAAATTGTGAAAAAAAATATATAGTGAAAGAGATTATATTATCAGTTTTACAAATATG
AACTACACTAATAGATGGATTTCTATTATTACAGAGATATTTGCTTTAGTCATAATCAGT
GGTACTGCATATTTCGGTGTTTTGAGTAAATAATTCAACTATTAAAGCAATGGTTCTTTG
ATTGGTTTAGCTCTTACATATAGTTTCTAAATTTCAGCTATTTTATCATTTACTCTTAAG
CTTATTGCAGACACTGAAAGTGGCATGAATGCTGTCGTTAGAATGCTTTAATATATTGAA
AAGAACCCACAAGAAAATGACTGGAGATCATAAAAACCTATTGAGAAATGGCCTCAATAA
GGTCAATATTAGCTAGATAAAATCACCTATAAATATAGAGAAGAATTGCCCACAGTTATC
AATGGTATTTCTTTTGACATCAAGAATAATGAAAAAATTGGTGTTGTTGGTAGAACTGGA
AGTGGTAAATCTACTTTGACTTTAGGTTTGATGAGAATTCTTGAACTAATTCAAGACAAT
AATGTAAATAAATTGCATTGTTTTTTTCTAAACAAAATAATAAAATAAATCAATTTAAAA
CAAATAAATAGGGATAACTTGGTAAAATTAGTTTAGATGGATAAAATATTAGAGATATTG
GATTACATGATTTGAGAGAAAAAGTAACTATCATTCCTTAGGATCCTCTATTATTCAGTG
GAACAATTAGATCAAATATCGATCCATATAAAAAATATACTGATTCGGAAATATGTGACG
TTCTTTAAAAAGTGGAGATCTGGAATTAACTTGACTCCATTCTTGAGAAATAGTTAGAAA
AAGAAAGTAAAGAAAAGAAATAAGGTGGCTAACTTTCAAACAATCCTAACTACTAGATGG
AGTAAATATAGAAGAAAAAATTAGAAATTGTTGTAGAAGGAGGAGGTTCAAACTTTTCTT
TAGGACAAAGACAATTGATATGCATTGCAAGAGCTTTGATTGTAATTATTTATTTAAGTT
TTTTTAAATTAAATTAATTATTTTACTTGAAAATAGAAAAAACCTAAAGTACTCTTGATG
GATGAAGCTACTGCCAGTATTGATGAAATGACTGATAGATTAATATAAAATATGATTAAA
AAAGAGCTTACTTAAGTAAATAAATTATATTTTATAGAATTTAATTAATATATTTAATCT
TTTTATTTAAATAGACCACAGTAGTTACTATTGCACACAGACTGAAAACAATTATTCAAT
ACGATAGAATAGTCGTTTTAGAACTTGGTAATTTGAAGGAAATAGAAACTCCATCAACTC
TCTTAGAAAATCCAAACAGCTATTTCTGTAAGCTTGTTAATTCTCATGGCAAATAATTCT
ATGATGAAATGAAATTGCTAGCTAAGAACAAAGAACTTGATGTCTATTGA