Identifiers and Description

Gene Model Identifier

TTHERM_00558100

Standard Name

MTSA5 (MethylTransferase targeting position N-Six of Adenine (MTSA) 5)

Aliases

PreTt07908 | 73.m00152 | 3735.m00046 | MTA5

Description

MT-A70 RNA methyltransferase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • nucleobase-containing compound metabolic process (IEA) | GO:0006139

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00558100

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14374.19.997093137033517e-262MT-A70 family protein (758 aa)
SGDYGL192W9.997975313387782e-28IME4 Probable mRNA N6-adenosin
e methyltransferase required f
or entry into meiosis; transcr
ibed in diploid cells; haploid
s repress IME4 transcription v
ia production of antisense IME
4 transcripts; antisense trans
cription is repressed in diplo
ids
OxytrichaContig17486.0.g1001.0000422327488734e-24MT-A70
Stentor CoeruleusSteCoe_234970.0000000000018795288165390832

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000146

Sequences

>TTHERM_00558100(coding)
ATGTAACCTCAACAGAATTAAAATTAGTAGCAATAATAATAGCAGCAATCATAGCAACAG
CAGTAATAAAATTAGCAACTGCCACAGCTTCAATAATCTATGTCTTCATAGCAGTAACAA
AATTAATAGTAAGAAAAATAAATTATAATAAAAAGAGGTACAACTTCAAAAAGAAACGAC
TACTGCTAGAATTTTGTTAATACTCATGAGCGTCCATAGAATTTTATTATGAATATCCGT
CCAGAAGAGCGTTTTATAGAATACCCAAAATTGCAAGATTTGATAAAATTTAAGGATGAT
TTAATTAAAAAGCGTAACCATCCTCCTGTATATTTAAAGGCTGATTTAAAATATTATGAT
TTGTCTAAGCTTGGTAAGTTTGATGTCATTATGATGGATCCACCTTGGAAGGAATATGAA
GAGAGAGTACAAGGTCTTCCCATATATAGCCAGTATCCTGAGAAATTTAATTCATGGGAT
CTAAATGAAATTGCTGCATTACCTATTGATGAAATTTCAGATAAACCTAGCTTTTTGTTT
TTATGGGTAGGCTCCGATCATTTAGATTAGGGAAGAGAACTGTTTAGAAAGTGGGGATAT
AAAAGATGTGAAGATATAGTTTGGGTAAAAACTAATAAAGATAAAACCAAAGAATATATA
GAATTACCTCATTCAAACCTTCTTGTGAGAGTTAAAGAACACTGTCTAGTAGGTTTACGT
GGAGATGTAAAAAGGGCTTCTGATTCTCATTTTATTCATGCAAATATAGATACTGATGTC
ATAGTAGCTGAGGAGCCTCCTCTTGGAAGTACTTAGAAACCTGCAGAAATATATGATATT
ATAGAGAGATTTTGCCTTGGAAGAAAGAGGTTAGAGTTATTTGGAGAAGTTCACAATGTC
AGATAAGGTTGGTTAACTATTGGAAAATTATTGGATGAAAGCAACTTTAATTAAGATGAG
TATAATAGTTGGTTTGATGGAGACAAAACTTATCCCTAAATATAAACCTATAGAGGTGGT
AGATATGTAGGAACAACACCTGATATAGAATAACTCAGGCCAAAATCTCCAACCAAAAAT
AATTAAATGAATTCAAACTAAAATATGTCTGGTTCTTAGGTTTCTGAATTTGACTTGGGA
ATACAATAGAAATAGCAAAAATTAAATCAGCAGTTTTGA


>TTHERM_00558100(protein)
MQPQQNQNQQQQQQQQSQQQQQQNQQLPQLQQSMSSQQQQNQQQEKQIIIKRGTTSKRND
YCQNFVNTHERPQNFIMNIRPEERFIEYPKLQDLIKFKDDLIKKRNHPPVYLKADLKYYD
LSKLGKFDVIMMDPPWKEYEERVQGLPIYSQYPEKFNSWDLNEIAALPIDEISDKPSFLF
LWVGSDHLDQGRELFRKWGYKRCEDIVWVKTNKDKTKEYIELPHSNLLVRVKEHCLVGLR
GDVKRASDSHFIHANIDTDVIVAEEPPLGSTQKPAEIYDIIERFCLGRKRLELFGEVHNV
RQGWLTIGKLLDESNFNQDEYNSWFDGDKTYPQIQTYRGGRYVGTTPDIEQLRPKSPTKN
NQMNSNQNMSGSQVSEFDLGIQQKQQKLNQQF


>TTHERM_00558100(gene)
ATGTAACCTCAACAGAATTAAAATTAGTAGCAATAATAATAGCAGCAATCATAGCAACAG
CAGTAATAAAATTAGCAACTGCCACAGCTTCAATAATCTATGTCTTCATAGCAGTAACAA
AATTAATAGTAAGAAAAATAAATTATAATAAAAAGAGGTACAACTTCAAAAAGAAACGAC
TACTGCTAGAATTTTGTTAATACTCATGAGCGTCCATAGAATTTTATTATGAATATCCGT
CCAGAAGAGCGTTTTATAGGTAATATTTTCAAAAATGAATTTATTTTTTAAGTGTTAAAT
TCAAATTCTAAAAAATTAATTGATTATTGAGCAGAATGAATGTCTATTGAAAACAAATTT
AAGAAATAAATGTGAATCAATCAAAATAAACTTTTCTTTTATTAAAATAGAATACCCAAA
ATTGCAAGATTTGATAAAATTTAAGGATGATTTAATTAAAAAGCGTAACCATCCTCCTGT
ATATTTAAAGGCTGATTTAAAATATTATGATTTGTCTAAGCTTGGTAAGTTTGATGTCAT
TATGATGGATCCACCTTGGAAGGAATATGAAGAGAGAGTACAAGGTCTTCCCATATATAG
CCAGTATCCTGAGAAATTTAATTCATGGGATCTAAATGAAATTGCTGCATTACCTATTGA
TGAAATTTCAGATAAACCTAGCTTTTTGTTTTTATGGGTAGGCTCCGATCATTTAGATTA
GGTATTTAAAAGAATTTATTAATGCATTTATTTACTTAGTAGACAGCTTAAACAATAAAA
ATATTAATAATTATGGGTGTTTTAATAATTAATTTTACATTTATTTTAATGTAGGGAAGA
GAACTGTTTAGAAAGTGGGGATATAAAAGATGTGAAGATATAGTTTGGGTAAAAACTAAT
AAAGATAAAACCAAAGAATATATAGAATTACCTCATTCAAACCTTCTTGTGAGAGTTAAA
GAACACTGTCTAGTAGGTTTACGTGGAGATGTAAAAAGGGCTTCTGATTCTCATTTTATT
CATGCAAATATAGATACTGATGTCATAGTAGCTGAGGAGCCTCCTCTTGGAAGTAAAAAA
TATAGCTTTTCCTTTAATCATTTTAAGATTTCATTTATATATTTTAATTGATATTTAAAA
AGGTACTTAGAAACCTGCAGAAATATATGATATTATAGAGAGATTTTGCCTTGGAAGAAA
GAGGTTAGAGTTATTTGGAGAAGTTCACAATGTCAGATAAGGTTGGTTAACTATTGGAAA
ATTATTGGATGAAAGCAACTTTAATTAAGATGAGTATAATAGTTGGTTTGATGGAGACAA
AACTTATCCCTAAATATAAACCTATAGAGGTGGTAGATATGTAGGAACAACACCTGATAT
AGAATAACTCAGGCCAAAATCTCCAACCAAAAATAATTAAATGAATTCAAACTAAAATAT
GTCTGGTTCTTAGGTTTCTGTAAATTTTTTTCATATTCATTCATAATATCAAAATAATTT
ATTTATTTTTTTAAGGAATTTGACTTGGGAATACAATAGAAATAGCAAAAATTAAATCAG
CAGTTTTGA