Identifiers and Description

Gene Model Identifier

TTHERM_00540350

Standard Name

None

Aliases

PreTt12193 | 70.m00189 | 3728.m00086

Description

tRNA pseudouridine synthase D

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01142 ) tRNA pseudouridine synthase D
  • ( TIGR00094 ) conserved hypothetical protein TIGR00094

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00540350

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18238.19.997093137033517e-262tRNA pseudouridine synthase D
(622 aa)
OxytrichaContig18150.0.g421.99927841627239e-68tRNA pseudouridine synthase D
(TruD)
SGDYOR243C3.0005221502158484e-68PUS7 Pseudouridine synthase, c
atalyzes pseudouridylation at
positions 35 and 56 in U2 snRN
A, position 50 in 5S rRNA, pos
ition 13 in cytoplasmic tRNAs,
and position 35 in pre-tRNA(T
yr); conserved in archaea, ver
tebrates, and some bacteria
DictyBaseDDB_G02716322.000597631390999e-64pus7 on chromosome: 2 position
580601 to 582875
WormBaseWBGene000071019.996696112986116e-50Putative pseudouridine synthas
e B0024.11 status:Partially_
confirmed UniProt:Q17426 p
rotein_id:CAA94883.1
Stentor CoeruleusSteCoe_56152.9374821117108028e-30

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00540350(coding)
ATGGAATAATAAAAAGAAACATTAGGAGAAACTAATGTAGGAATTACTGCCTTTTTAACC
TAAGGTAAACCTTTCAAGGGCATTGTTAAGTATAGAATTTAAGATTTTATTGTAAATGAG
GTGACTTAAGAAAAAGAGACACTTTATCCTTCTGAGAAGACAATATTTTAGAAATAAAAT
AATTAGAAGAAAGATTAAAGCAATTAAGAGGCTCCTCAAGAAGAAAAAAAATCAGAATAT
GAAATTTCTGATGAGCTTTCCTAGAAGATAAAAGAAATATTCGGGTAGGAAAAAGGAGAA
AAGATGATAAAGTTTTATAATGATTTAGAAGCAGGCTTGAAGGCTAAAGAAAACGAATTT
AGTATTTTAATAGACTGCCCAGATGAAAAGGAGGAGAGACTCAAAATTCATTAATTTGTG
AGAGAGGAGCTAATTCATATGGACTCATCCACTGAGGGAGATAATGCAAAAAAGTCTATT
AAAGTATTTTTTACAAAAAACAAAGCAAAAAGAGGTAAAATTGACCAAAAGGTTTACCAT
TGCGTTTTATTTAAAAATGGCATAGATAACTTTACTGCCATTCAAAACATCAGCAAATAT
CTGAGATTACCTCCAAAGAATATTAACGCTGCTGGTATTAAAGACAAAAGAGGAATCACT
ACTCAACTTATAAGTATTGCTATGAGTAACACATCAGCTGAGATACTCAATCAAAGATTC
CAAAATTCAAGATGGAACAATATGAAGGTCTAAAATGTTAAAGATGCTACTTCTCAACTT
AGAACTGGTGATTTGTACGGAAATAGATTTTCATTAGCAATTAGACTGGTTTCGTACGAA
GAATAAGAAGTCATAAAAGCAGTTGAAGACCTTAAAAAATTAGGGTTTATCAATTATTTT
GGTATGTAACGTTTTGGCACAAATAATAGCATTCATACTCACGAAATAGGTTTACTCATC
CTAAAAAGACAGTGGGAATAAGTTTTTGATTCAATAGTCGGATAAGAAACAAATGATAAA
AGAGTAAATGAAGCTAAAAAAGCTTTCTTAAAGGATAAAACTTAAATTAGAGATGCTTTG
AGAGACATTCCCTTTAAATACAAAATAGAAAGAACATTGTTGTAAGGTTACGAAAGAGTA
GGTATGAAAAATAATTTCCTATAAGCCATTTGCTTTTTAAACAGGAGCACTAGAAATCTT
TATTGTCACGCTTATTAGAGCTATATATGGAATCTACTTGCTTCTTATAGAATTCAGACA
TTAGGTAACTAGCTTGTTAAGGGGGATATAGTAGCAAAAAAGAGAGAGAATTTTTTGATA
GATGTTGAAGCTGAAGTCGAAGAAGAAAATGGCTAAGAGGAAGAGTAAGAAGAAGAATCT
AAATATTAAAGCATTGGTGATTATGAAATTGAAGTGATAGACGACTCAAATATTGATAAA
TATACTCTCTATGATGTTCTAATTCCTATTATAGGAGGAAAACTCAAAATACCTGAAAAT
TTTAATTTAAATGCTTACCTCACCTCAATTTTAGAAAAAGATGGTCTTGATTAACAATTG
TTTGAAAAAATCTAAAAGGAATTTTTTGTAGAAGGAGGTTATAGATTTTTAATATGTTAA
GCTGAAGACGTTTAATATTCCATTAATAAATACAATGAGAAAAACTAGGACATTCTCACT
CCTTACTACAACGTTTAGCAAGATCACTCAGAAGAAAATGGTAAATATAGTGCCCTTTGT
TTAAAGTTTACTCTTGCGAAAGGTTCATATGCAACTATGCTAATCAGAGAATTAACGAAA
ATGCCTTCTGATTTTGACACCTAAATGGGTTTAAATAAAGAGTACTAACAATTAGAATGA


>TTHERM_00540350(protein)
MEQQKETLGETNVGITAFLTQGKPFKGIVKYRIQDFIVNEVTQEKETLYPSEKTIFQKQN
NQKKDQSNQEAPQEEKKSEYEISDELSQKIKEIFGQEKGEKMIKFYNDLEAGLKAKENEF
SILIDCPDEKEERLKIHQFVREELIHMDSSTEGDNAKKSIKVFFTKNKAKRGKIDQKVYH
CVLFKNGIDNFTAIQNISKYLRLPPKNINAAGIKDKRGITTQLISIAMSNTSAEILNQRF
QNSRWNNMKVQNVKDATSQLRTGDLYGNRFSLAIRLVSYEEQEVIKAVEDLKKLGFINYF
GMQRFGTNNSIHTHEIGLLILKRQWEQVFDSIVGQETNDKRVNEAKKAFLKDKTQIRDAL
RDIPFKYKIERTLLQGYERVGMKNNFLQAICFLNRSTRNLYCHAYQSYIWNLLASYRIQT
LGNQLVKGDIVAKKRENFLIDVEAEVEEENGQEEEQEEESKYQSIGDYEIEVIDDSNIDK
YTLYDVLIPIIGGKLKIPENFNLNAYLTSILEKDGLDQQLFEKIQKEFFVEGGYRFLICQ
AEDVQYSINKYNEKNQDILTPYYNVQQDHSEENGKYSALCLKFTLAKGSYATMLIRELTK
MPSDFDTQMGLNKEYQQLE


>TTHERM_00540350(gene)
ATGGAATAATAAAAAGAAACATTAGGAGAAACTAATGTAGGAATTACTGCCTTTTTAACC
TAAGGTAAACCTTTCAAGGGCATTGTTAAGTATAGAATTTAAGATTTTATTGTAAATGAG
GTGACTTAAGAAAAAGAGACACTTTATCCTTCTGAGAAGACAATATTTTAGAAATAAAAT
AATTAGAAGAAAGATTAAAGCAATTAAGAGGCTCCTCAAGAAGAAAAAAAATCAGAATAT
GAAATTTCTGATGAGCTTTCCTAGAAGATAAAAGAAATATTCGGGTAGGAAAAAGGAGAA
AAGATGATAAAGTTTTATAATGATTTAGAAGCAGGCTTGAAGGCTAAAGAAAACGAATTT
AGTATTTTAATAGACTGCCCAGATGAAAAGGAGGAGAGACTCAAAATTCATTAATTTGTG
AGAGAGGAGCTAATTCATATGGACTCATCCACTGAGGGAGATAATGCAAAAAAGTCTATT
AAAGTATTTTTTACAAAAAACAAAGCAAAAAGAGGTAAAATTGACCAAAAGGTTTACCAT
TGCGTTTTATTTAAAAATGGCATAGATAACTTTACTGCCATTCAAAACATCAGCAAATAT
CTGAGATTACCTCCAAAGAATATTAACGCTGCTGGTATTAAAGACAAAAGAGGAATCACT
ACTCAACTTATAAGTATTGCTATGAGTAACACATCAGCTGAGATACTCAATCAAAGATTC
CAAAATTCAAGATGGAACAATATGAAGGTCTAAAATGTTAAAGATGCTACTTCTCAACTT
AGAACTGGTGATTTGTACGGAAATAGATTTTCATTAGCAATTAGACTGGTTTCGTACGAA
GAATAAGAAGTCATAAAAGCAGTTGAAGACCTTAAAAAATTAGGGTTTATCAATTATTTT
GGTATGTAACGTTTTGGCACAAATAATAGCATTCATACTCACGAAATAGGTAAAAATATT
AACACTATAAAAAAAATTAAATTACTCAAACAAAAATATAATAAAATTTTTAATTTATGG
GTGATTTTTAGCAATTTTTATTTTTTAATTAGGTTTACTCATCCTAAAAAGACAGTGGGA
ATAAGTTTTTGATTCAATAGTCGGATAAGAAACAAATGATAAAAGAGTAAATGAAGCTAA
AAAAGCTTTCTTAAAGGATAAAACTTAAATTAGAGATGCTTTGAGAGACATTCCCTTTAA
ATACAAAATAGAAAGAACATTGTTGTAAGGTTACGAAAGAGTAGGTATGAAAAATAATTT
CCTATAAGCCATTTGCTTTTTAAACAGGAGCACTAGAAATCTTTATTGTCACGCTTATTA
GAGCTATATATGGAATCTACTTGCTTCTTATAGAATTCAGACATTAGGTAACTAGCTTGT
TAAGGGGGATATAGTAGCAAAAAAGAGAGAGAATTTTTTGATAGATGTTGAAGCTGAAGT
CGAAGAAGAAAATGGCTAAGAGGAAGAGTAAGAAGAAGAATCTAAATATTAAAGCATTGG
TGATTATGAAATTGAAGTGATAGACGACTCAAATATTGATAAATATACTCTCTATGATGT
TCTAATTCCTATTATAGGAGGAAAACTCAAAATACCTGAAAATTTTAATTTAAATGCTTA
CCTCACCTCAATTTTAGAAAAAGATGGTCTTGATTAACAATTGTTTGAAAAAATCTAAAA
GGAATTTTTTGTAGAAGGAGGTTATAGATTTTTAATATGTTAAGCTGAAGACGTTTAATA
TTCCATTAATAAATACAATGAGAAAAACTAGGACATTCTCACTCCTTACTACAACGTTTA
GCAAGATCACTCAGAAGAAAATGGTAAATATAGTGCCCTTTGTTTAAAGTTTACTCTTGC
GAAAGGTTCATATGCAACTATGCTAATCAGAGAATTAACGAAAATGCCTTCTGATTTTGA
CACCTAAATGGGTTTAAATAAAGAGTACTAACAATTAGAATGA