Identifiers and Description

Gene Model Identifier

TTHERM_00538950

Standard Name

None

Aliases

PreTt12152 | 70.m00148 | 3728.m00047

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00102 ) Protein-tyrosine phosphatase
  • ( TIGR01492 ) Plasmodium falciparum CPW-WPC domain
  • ( PF00782 ) Dual specificity phosphatase, catalytic domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00538950

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18205.19.997093137033517e-262hypothetical protein (486 aa)
OxytrichaContig15909.0.g952.998893725394183e-91C2 domain of PTEN tumour-suppr
essor protein
DictyBaseDDB_G02859671.0001267035975107e-72DDB_G0285967 on chromosome: 4
position 3881074 to 3884386
WormBaseWBGene000009137.003455847728069e-40locus:daf-18 status:Confirme
d UniProt:G5EE01 protein_i
d:CCD73977.1
Stentor CoeruleusSteCoe_196309.602680054508676e-24
SGDYNL128W0.00000005999527666938375TEP1 Homolog of human tumor su
ppressor gene PTEN/MMAC1/TEP1
that has lipid phosphatase act
ivity and is linked to the pho
sphatidylinositol signaling pa
thway; plays a role in normal
sporulation

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00538950(coding)
ATGGCATCATAACCAATTTAAGGAAACATATTTGAACCCAACTAAGATAATTAGAAGGGG
TATTCTTATGATGACGATTACTATGAAGAATAAAATAATGTCTTTGACAATGCAAGCTAA
TCATCTGATAATGAAGTTCAATATGACTATTATTATGGCGATAGCGATTAAGATGAAGCA
GAGGTTTAAGAAATAAGTTAAATTCCTGCCCAAACCGAATTAAATCGTAAAACAACAACG
CAGTTAGATGAAGAAGCAACAAGAATCAATAAAGCATTTAATAAAGACAAAAAAAAATAT
TTCAGGAACTACATAAAGATGCTAGTTTCAAAACAAAAAAAAAGATTTGAGTCAGATGAA
TTCTCCCTCGATTTAACATATATAACATCAAAGATTATAGCTATGGGGTTTCCTGCAGAC
AAATTGGAGAGTCTTTACAGAAATGATCGTAAAGAAGTGAAAAACTTCTTCAAAAAATAG
CATCAAGATAGTTACAAGATATATAATTTATGTTCGGAAAGAGAATACAATAAAGAAGAA
TTTTAAAATTTTGCTCATTATCCTTTTGAAGATCATTAAGCACCAGAGTTTTAACTGATA
TACAACTTTTGCAAAGACCTGTTTAAATTTATTTATGAAGAGGGTAATGGCGAGAATATT
GCTGCAGTTCATTGCAAAGCAGGAAAAGGTAGAACTGGAGTGATGATATGTTGTTTCTTA
ATGTTCTCAGGAGTTTATGAAAAAGCTATAGATTCTTTACGTTACTATGGCATAATGAGA
ACGAAAAATAAAAAGGGAGTAACTATTCCAAGCTAAATAAGATATGTATAGTACTTCGAA
AAAGCGCTATAATGCAGATATAACTTAGAAAATTTTCCTAGAATCAACCTCAAATTACTA
AAGATAAAACTAGTCACAATTCCTAATTTTAATTTCTTTGGTGGTTGCGAGCCATTCTTT
ACAATTACTTACTTTTAAGATAATAAGGAAAAAACAGAATACAATTCGCTAGACAACTTT
AAATTATAAAAATACCATAAAGAGCCATATATAGAATTTGTTTTAGATGAATATGAAGTT
AAAGGCGATGTTTAAATTCAATTCTTTAATAAATCTCTCCTTAAAAAGAAAGAAAAAATG
TTTTAATTTTGGTTTAACTGTGCTTTCTTTGAGCCAAATGGAGTACTAGTCCTTGATAAA
AATTAGCTAGATTCTGCATGCAAGGATAAAAAGCACAAATAATTTAGCGAAGCATTCCAT
GTAGAAGTACACGCTTTAAGACCAAATTAATAATAGGAAATATAAATTATGAGTGAAGAA
AACGGATATTTATAAGTAAATAAAAGAAAAAAAGAAGAATATGAAAGTAGAATGAAGATG
AAACAGGGTGCTTCAACTTTCAATCAATAAAATATCCCATAAAATTTAGAAATTGATAAA
ATAAATATATTTTAGTTACAGAAGAACTAAAAAAATTGA


>TTHERM_00538950(protein)
MASQPIQGNIFEPNQDNQKGYSYDDDYYEEQNNVFDNASQSSDNEVQYDYYYGDSDQDEA
EVQEISQIPAQTELNRKTTTQLDEEATRINKAFNKDKKKYFRNYIKMLVSKQKKRFESDE
FSLDLTYITSKIIAMGFPADKLESLYRNDRKEVKNFFKKQHQDSYKIYNLCSEREYNKEE
FQNFAHYPFEDHQAPEFQLIYNFCKDLFKFIYEEGNGENIAAVHCKAGKGRTGVMICCFL
MFSGVYEKAIDSLRYYGIMRTKNKKGVTIPSQIRYVQYFEKALQCRYNLENFPRINLKLL
KIKLVTIPNFNFFGGCEPFFTITYFQDNKEKTEYNSLDNFKLQKYHKEPYIEFVLDEYEV
KGDVQIQFFNKSLLKKKEKMFQFWFNCAFFEPNGVLVLDKNQLDSACKDKKHKQFSEAFH
VEVHALRPNQQQEIQIMSEENGYLQVNKRKKEEYESRMKMKQGASTFNQQNIPQNLEIDK
INIFQLQKNQKN


>TTHERM_00538950(gene)
ATGGCATCATAACCAATTTAAGGAAACATATTTGAACCCAACTAAGATAATTAGAAGGGG
TATTCTTATGATGACGATTACTATGAAGAATAAAATAATGTCTTTGACAATGCAAGCTAA
TCATCTGATAATGTAAGATGCACAATTTTATAAATAAGGCTGTTAGATTTTGCTTGGATT
TTACATAGAAAATCTGCAAAGATAATTAATTTATTTTGTTTAAACTAGGAAGTTCAATAT
GACTATTATTATGGCGATAGCGATTAAGATGAAGCAGAGGTTTAAGAAATAAGTTAAATT
CCTGCCCAAACCGAATTAAATCGTAAAACAACAACGCAGTTAGATGAAGAAGCAACAAGA
ATCAATAAAGCATTTAATAAAGACAAAAAAAAATATTTCAGGAACTACATAAAGATGCTA
GTAAAATTATTTTGAATAAATAAATTATGAGAAATATTGCAAAAAAAAATTTAATCAGCT
ATAAATCTAATTATTTTAAGGCTTGTCTTATATTTCATTGCTTGCTACTTATATAATCAA
CAAGGAATAGATAGAATAATACTATCAAATATGTCAACAAAATTTATTGATAATCTTTAT
TTTATAAAATATACAGGTTTCAAAACAAAAAAAAAGATTTGAGTCAGATGAATTCTCCCT
CGATTTAACATGTAGGCATTATTTATTAAGTTTATAAAATAAGTTAAAAAGCACTACTTT
AAATAACTTCAAAGCAAACTTACTTAATGATAGTGAGAAAAATATTTAAAATTTCAATTT
AGCAAAATAATTTGTTACTATTTAAATAAATATAAAGATGATTTTAGTAAAATGAGCATT
ATTGTTTATATTTATACAAATAGATATAACATCAAAGATTATAGCTATGGGGTTTCCTGC
AGACAAATTGGAGAGTCTTTACAGAAATGATCGTAAAGAAGTGAAAAAGTATAGAATATT
TCATTTACATTAATTTATTTTATAAAAGCAAAAAATACTGGCACTTTTATGAATTTATTA
ATGAATGATTATTTTTCCATATAAAAGCTAAAACTTTATACATCAAATTAACAGGCTTTG
AAAGAGATAAATCCATTCAAATTCATTGAAAAAAATTTTTTTTTTCCTAAATACTTTGAT
AAAAAGTCGATAAAATATTGCAAAATTAAATTTTTGTGGTAATAACTATTTTAATAGAAA
AGCAAATTATGTTCGGTAATCTAAGAAATTTTAAGAATTATTATAAAATTTGTTTTTTTA
TTCTTTTTAGTCCTACGTCTATTCATAATTTTTATCAAAATTTCCAATTTTGATTTTTTA
TCAATTTTACCCAGTTCTATTATTATTCTAGCCTTGTTACTCTTTCTAAATTAAGTACAA
CCATAAAAATTTTATGCCAAAATACTTGGTAGAAAAATATAATTTTAAAAGACTTTCTCT
TAATATTTTTTATAATCCTAATATAACCAAACCAAGCATAATTATTTTAAATATAAATCT
AATTTAACTAATGAATCAACTAATTATTTAGTGTATGCTGAATATAAAAGAATTAAGAGC
ATGATGATTGAATATATTTATTAGATTTTAATTAAAATTTTTTACTGATTAACTTCTTTA
TTTTTACTGATAAATTAAGAAAGAAAAATAGATAAATATTATTGTTACTTTTATTATTTA
GATAAACCTCAAATTAAAAATTAAAAACATATTTTGAATATTTTTTTCAAGATTATGTTA
TGTTTACTTTTTTTATTTATTAATAATCTGCAAAAAATTAATAAATACAAGTAATTTTTT
TAGATAACTCTATAAATTGAATAAATTTATCAATAAATAAGATAATTTAATTATTTTAAT
TAACAGCAATAATAATTATAATAAAGAGTAATATAGCTAATAATATAATATTTATTGATT
AATTTTCTTTTTTTTAAAATCAGATAAGTTAGAAAGACTTTTAAATTACTATAATTAATT
CATTTTTTTAAATTATTTTAGCTTCTTCAAAAAATAGCATCAAGATAGTTACAAGATATA
TAATTTATGTTCGGAAAGAGAATACAATAAAGAAGAATTTTAAAATTTTGCTCATTATCC
TTTTGAAGATCATTAAGCACCAGAGTTTTAACTGATATACAACTTTTGCAAAGACCTGTT
TAAATTTATTTATGAAGAGGGTAATGGCGAGAATATTGCTGCAGTTCATTGCAAAGCAGG
AAAAGGTAGAACTGGAGTGATGATATGTTGTTTCTTAATGTTCTCAGGAGTTTATGAAAA
AGCTATAGATTCTTTACGTTACTATGGCATAATGAGAACGAAAAATAAAAAGGTAAAAAA
CACCCAAAATTAATTTTAACAAAAAAAAACATTAATTATTTTAAATAAATTCATAAAAGG
GAGTAACTATTCCAAGCTAAATAAGATATGTATAGTACTTCGAAAAAGCGCTATAATGCA
GATATAACTTAGAAAATTTTCCTAGAATCAACCTCAAATTACTAAAGATAAAACTAGTCA
CAATTCCTAATTTTAATTTCTTTGGTGGTTGCGGTAAAAATTATTAAAAACTTAAAAACA
TTTATTTAATGATCTTAAAAAATATAATAGAGCCATTCTTTACAATTACTTACTTTTAAG
ATAATAAGGAAAAAACAGAATACAATTCGCTAGTAAATTATTTAATTTTTTTATATTTTC
ACTTAAAAATATTTTTTTTTAAACAAAGGACAACTTTAAATTATAAAAATACCATAAAGA
GCCATATATAGAATTTGTTTTAGATGAATATGAAGTTAAAGGCGATGTTTAAATTCAATT
CTTTAATAAATCTCTCCTTAAAAAGTGATTACTTTTCACATAAAATATAAATTAATTTTT
AATTCATTTAAAAAGGAAAGAAAAAATGTTTTAATTTTGGTTTAACTGTGCTTTCTTTGA
GCCAAATGGAGTACTAGTCCTTGATAAAAATTAGCTAGATTCTGCATGCAAGGTAGAAAT
AATATATTTTATTTTTTACACTCTCTTATATGATTATAAATTTTTTAGGATAAAAAGCAC
AAATAATTTAGCGAAGCATTCCATGTAGAAGTACACGCTTTAAGACCAAATTAATAATAG
GAAATATAAATTATGAGTGAAGAAAACGGATATTTATAAGTAAATAAAAGAAAAAAAGAA
GAATATGAAAGTAGAATGAAGATGAAACAGGGTGCTTCAACTTTCAATCAATAAAATATC
CCATAAAATTTAGAAATTGATAAAATAAATATATTTTAGTTACAGAAGAACTAAAAAAAT
TGA