Identifiers and Description

Gene Model Identifier

TTHERM_00534050

Standard Name

None

Aliases

PreTt19962 | 68.m00251 | 3830.m00611

Description

Protein kinase domain containing protein. Sequence similarity to a protein kinase family unique to Tetrahymena thermophila (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00534050

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11918.19.997093137033517e-262protein kinase domain-containi
ng protein (649 aa)
OxytrichaContig17327.0.g231.9990002532767049e-131Protein kinase domain
DictyBaseDDB_G02715501.0004460510701209e-64DDB_G0271550 on chromosome: 2
position 634463 to 636022
WormBaseWBGene000005531.9990871925214856e-61locus:cmk-1 Calcium/calmodul
in-dependent protein kinase ty
pe 1 status:Confirmed UniP
rot:Q9TXJ0 protein_id:CCD718
65.1
SGDYPL153C4.997860539111522e-53RAD53 Protein kinase, required
for cell-cycle arrest in resp
onse to DNA damage; activated
by trans autophosphorylation w
hen interacting with hyperphos
phorylated Rad9p; also interac
ts with ARS1 and plays a role
in initiation of DNA replicati
on
Stentor CoeruleusSteCoe_10852.0842828425817514e-52

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00534050(coding)
ATGGGTCAAACCTGTGCTGGGGCTAAGCCATCCGCTGAGCATAAAAAAAATAAATAAATA
AACAATTTGTAGAATCAAAAGGAAGGCGAAAATAAGTTTGCTGCTGATACTGATTCTTAA
AAAACTAATTCACCAATAATAATTCTAAAGAAGCAAAAACCATTTTCTCAAGAAATAATC
ACTTCATTCGAGGATATAAGGAAAGTTTATGAGTTTGAGCCTAATATTTTAGGTCATGGG
CATTATGGAACAGTTAGGTTAGCTAATCATATTATCAACAAATCGAAAAAATATGCAGTT
AAAACTATCTCGAAGACTAAGATAAAAAAAGATTTACATCTCTTTAGAAGGGAGCTCGAA
ATTTTGAAAAGTCTAGACCATCCTAATGTAATTAAATTTTATGAGACTTATCAAGACAAA
AAGTATTTCCACCTTGTTATGGAGTACTGTTCAGGTGGAGAATTACTTCATCGTATTGCA
TAAGATAAGATGGCATCTGAAGAAAAGATGGTAAAGATAATGAAAAAAATATTCCTTGGA
GTAAAGTACCTACATGAAAAGGGAATTTGCCATCGTGACTTAAAACCTGAAAATTTTCTT
TTCTCAAACAACTCTGAATTGAGCGAGATTAAGATTATCGATTTCGGCTTGTCGACATAT
ATAGATGAGATTGAAAATGAAGACGATAATGGATTTTTCGGGAATGATCTTCAAACTATT
TGTGGTACTGCTAATTATTTAGCTCCTGAGGTTATCAAAGGAAAGTATGATAAAAGATGC
GATATTTGGAGTCTTGGAGTGCTCCTCTATTTCTTGCTTTGCGGCGAGCTTCCTTTTTCA
GGAAATACCAACACAGAGATATTTGATAAGATATTAAATTAGAAAGTAGAATTCTAGGGA
AATAATTGGAAAAAAGTGTCTAAAGAGGCTAAAGATTTGGTTAAAAAATTATTGGTAGTC
AATCCTGATGATAGAATAACTCTAGAATAGGTTTTAAAACATCCTTGGATTACTAAACTA
CCATAAAAAAAGCCTTTAGGCTCTGATGGAGAGGACTAGAGAGTTTTAAGCATGCTAAGA
AATCACTAAAGCACAGCTAAATTTAAAAAGGAGGCCTTAAAAGTTTTAGTAAATTTCTTA
GAAGAAGAGGAAATCTAAGAACTTAAGCAAATATTTAGGAAAATTGATACAAATAACACT
GGTATGATAAAAATTGAAGAGCTTTAAAGCGCATTAAAGAAAGTAGGATTAAATGATTCT
GAAGAAGAAGTGAAACGTATTATGCAGACTGTTCATATAGATGAAAAGAGTAATTAAATT
AACTACAGTGCATTTATAGCTGCAACTTTAGATGAGAAGAAATTCTTCAACAAAGAAAGA
CTTTGGAATGTTTTCAAGCATTTTGATGTTGATGACACTAATTACATCACAATATCTAAT
CTTAGAGAAGCTCTCGCTAGAGCTGGTAGAAAAGTTGATAACTAAGAATTATAGGAAATC
ATGAATGAAGTTGATTTTAATTTAAACTAAAGAATAGAGTGGAACTAGTTTGTAACGATT
ATGACTTAGACTGGTAACACAAAAACCCGTTAACACATAGACAGATCTTTATCATAAATA
AGCAATTTTAAGGAAAATAATTAAGAATCAGCTAAAAATCAAAACGAAGAACCAAATTAA
ACTGGTATTGCTACTTCTTAAGTTACTTATAATTAGAGAAAATCATCTTTTGAAGTTGAT
GAAGCAGCTAAGCGTTTTAGTGATGACCTTATAAATAATTCACCTTAATAATAGAAAGAA
ATGTACGTCAATTAAAATTAATATGATAAAGAAGATGAGAAAGGTCATAATAAAATAAAT
TAAATAACTCATAAAAATGAGTAATAATCCAAGATGCAATCATAGCTTAATTGA


>TTHERM_00534050(protein)
MGQTCAGAKPSAEHKKNKQINNLQNQKEGENKFAADTDSQKTNSPIIILKKQKPFSQEII
TSFEDIRKVYEFEPNILGHGHYGTVRLANHIINKSKKYAVKTISKTKIKKDLHLFRRELE
ILKSLDHPNVIKFYETYQDKKYFHLVMEYCSGGELLHRIAQDKMASEEKMVKIMKKIFLG
VKYLHEKGICHRDLKPENFLFSNNSELSEIKIIDFGLSTYIDEIENEDDNGFFGNDLQTI
CGTANYLAPEVIKGKYDKRCDIWSLGVLLYFLLCGELPFSGNTNTEIFDKILNQKVEFQG
NNWKKVSKEAKDLVKKLLVVNPDDRITLEQVLKHPWITKLPQKKPLGSDGEDQRVLSMLR
NHQSTAKFKKEALKVLVNFLEEEEIQELKQIFRKIDTNNTGMIKIEELQSALKKVGLNDS
EEEVKRIMQTVHIDEKSNQINYSAFIAATLDEKKFFNKERLWNVFKHFDVDDTNYITISN
LREALARAGRKVDNQELQEIMNEVDFNLNQRIEWNQFVTIMTQTGNTKTRQHIDRSLSQI
SNFKENNQESAKNQNEEPNQTGIATSQVTYNQRKSSFEVDEAAKRFSDDLINNSPQQQKE
MYVNQNQYDKEDEKGHNKINQITHKNEQQSKMQSQLN


>TTHERM_00534050(gene)
ATGGGTCAAACCTGTGCTGGGGCTAAGCCATCCGCTGAGCATAAAAAAAATAAATAAATA
AACAATTTGTAGAATCAAAAGGAAGGCGAAAATAAGTTTGCTGCTGATACTGATTCTTAA
AAAACTAATTCACCAATAATAATTCTAAAGAAGCAAAAACCATTTTCTCAAGAAATAATC
ACTTCATTCGAGGATATAAGGAAAGTTTATGAGTTTGAGCCTAATATTTTAGGTAACTTT
ATATGATTTGTTTGCGTCAAAAATGGCCTTAAATATTTGAAAATAATTTCCGAAAAATGG
AAATTCAAAAGCATGAGCTCCATTAAAAAGGATATAAGCAACAACAAACCATAATCTCTT
TTTATTAATTTACTTAGAAATAAGTGTTTTGTATGTAAAAAGATAATTTAGTTATATTGT
TCAATATGCTCCTTTAATTTGAATACAAACAAATTAATTAAGGATTATTTTTTAACAGGC
CTTTTAGTTTAATTGAATATATAAATAACTACTTTATTTAACAACTCAATTATCTTAATT
TATTTAAAACTTAATACAATTAAGGTCATGGGCATTATGGAACAGTTAGGTTAGCTAATC
ATATTATCAACAAATCGAAAAAATATGCAGTTAAAACTATCTCGAAGACTAAGATAAAAA
AAGATTTACATCTCTTTAGAAGGGAGCTCGAAATTTTGAAAAGTCTAGACCATCCTAATG
TAATTAAATTTTATGAGACTTATCAAGACAAAAAGTATTTCCACCTTGTTATGGAGGTAA
ATCTTTATTTTTATATTTTTATATTTAATTGAATAAGAGATAATTTATCTCTTAGATATT
TGAGTACTACTGAGAGTATGTTTGAATTACCATATGAAAAATTAGAAATAACTACAATTT
TTTTCCATCAGTAATTTTAAACATTGTTTAATTAATTGTCTCTATGTTCATGCCTTATTT
ATCCTACTTCTTTTAAAATCTGATTTTATTTGAGAAAATATTGTTTTAAATAACTGGATG
AAAGATTTAATTTTGTGGTATGCTTGCAAGTTCATTTTAAGGAATTTATTGATGGAAAAG
GATCAACTGAAATTATTTGTTTTGAATAAATTGAATCTAAATTGTTGTAAGGATGTAAAA
AAGGAATATTCGTTCTTCTTCAAAAATTTGAAGATAAATTTATTAAAGTTGATAATGCTT
TTTTGTACGCTTGAAACGATATTGATTATCTATCAATCTATCTTGTATGTACTTGCCTGA
AAATTTGAAATTGTTAAAATAAATTATTTGTTCACTATTTTAAACCCAGAAATATCAATT
TTAAATAGAATGATTAGATAGATATTAATTACGTTTTATGTCTAGCCATGTATTTTTGTT
TAAAATAAATTACTTTCTGATTATTAAACAATGCTTAAAATACTCTCAATCCTAAAAAAA
TTATTTTATTATTGATAGTTAATATATAACATATTTATTTTTTTAAAAAACATAGTACTG
TTCAGGTGGAGAATTACTTCATCGTATTGCATAAGATAAGATGGCATCTGAAGAAAAGAT
GGTAAAGATAATGAAAAAAATATTCCTTGGAGTAAAGTACCTACATGAAAAGGGAATTTG
CCATCGTGACTTAAAACCTGAAAATTTTCTTTTCTCAAACAACTCTGAATTGAGCGAGAT
TAAGATTATCGATTTCGGCTTGTCGACATATATAGATGAGATTGAAAATGAAGACGATAA
TGGATTTTTCGGGAATGATCTTCAAACTATTTGTGGTACTGCTAATTATTTAGCTCCTGA
GGTTATCAAAGGAAAGTATGATAAAAGATGCGATATTTGGAGTCTTGGAGTGCTCCTCTA
TTTCTTGCTTTGCGGCGAGCTTCCTTTTTCAGGTATAACAACTTCTTTTTTTATTCTTAT
TTCTAAATTCGTCATATTGAATCTGTTAAAGGAGATTAAGAAGGTATTATTTTTATTAAA
AGTGTACTAAAATTAGAATTTGAAAAGTTATTAAAATAAGAAAAATTAAGTAAGAATGAA
TGATTGAACAATTAATTAATTAAGTTAACTTATTTAAAAAGGCTTGTTTGTTTGAATTTT
TTACTAGCAAGCTTAATTTTTATAACCATCTTTCTTTCATTTGAAAAATTAAATCAAAAA
TCAATCCACTTCTAGAAATTTTAAATGAGTTATTAAAAATAATTTTACAAGATACAAGAT
AGGTAACTAAAAAATAAAAATTAATAAAAATACTTTTAGAAGCAAGCGCTAATCAATTTA
TTTGTTAAGAATAAATATAATATCTCCAAAAAAAAATAAATTTATTTGACAAATCAACCA
ATCATATAAGCTAACTGAAATCAAAAAAATAATAGGATAAATTTATAATTTCATCTTAAT
TTATGAAAATTAAAACTCAAAAATTAAATATTTATTTTATATATTCGATTATCTCAAATT
CATTTGACGATATAGAAAGATATCAATGATTATTTTTAATTGTTGTCGCACTAAAATTTA
AAAATAAGACTTTAAATCTAAACTTTAATATTAAAAATAGGAAATACCAACACAGAGATA
TTTGATAAGATATTAAATTAGAAAGTAGAATTCTAGGGAAATAATTGGAAAAAAGTGTCT
AAAGAGGCTAAAGATTTGGTTAAAAAATTATTGGTAGTCAATCCTGATGATAGAATAACT
CTAGAATAGGTTTTAAAACATCCTTGGATTACTAAACTACCATAAAAAAAGCCTTTAGGC
TCTGATGGAGAGGACTAGAGAGTTTTAAGCATGCTAAGAAATCACTAAAGCACAGCTAAA
TTTAAAAAGGAGGCCTTAAAAGTTTTAGTAAATTTCTTAGAAGAAGAGGAAATCTAAGAA
CTTAAGCAAATATTTAGGTAAATTGCAATCAATATAAATGAATTAAGCAAATAAACTTAA
AAATAATTTAATATATAGGAAAATTGATACAAATAACACTGGTATGATAAAAATTGAAGA
GCTTTAAAGCGCATTAAAGAAAGTAGGATTAAATGATTCTGAAGAAGAAGTGAAACGTAT
TATGCAGACTGTTCATATAGATGAAAAGAGTAATTAAATTAACTACAGTGCATTTATAGC
TGCAACTTTAGATGAGAAGAAATTCTTCAACAAAGAAAGACTTTGGAATGTTTTCAAGCA
TTTTGATGTTGATGACACTAATTACATCACAATATCTAATCTTAGAGAAGCTCTCGCTAG
AGCTGGTAGAAAAGTTGATAACTAAGAATTATAGGAAATCATGAATGAAGTTGATTTTAA
TTTAAACTAAAGAATAGAGTGGAACTAGTTTGTAACGATTATGACTTAGACTGGTAACAC
AAAAACCCGTTAACACATAGACAGATCTTTATCATAAATAAGCAATTTTAAGGAAAATAA
TTAAGAATCAGCTAAAAATCAAAACGAAGAACCAAATTAAACTGGTATTGCTACTTCTTA
AGTTACTTATAATTAGAGAAAATCATCTTTTGAAGTTGATGAAGCAGCTAAGCGTTTTAG
TGATGACCTTATAAATAATTCACCTTAATAATAGAAAGAAATGTACGTCAATTAAAGTAA
TAAAATTTTAATTTCAATCTAATACTTATCTAAATTTTATTTTAATAATAGATTAATATG
ATAAAGAAGATGAGAAAGGTCATAATAAAATAAATTAAATAACTCATAAAAATGAGTAAT
AATCCAAGATGCAATCATAGCTTAATTGA