Identifiers and Description

Gene Model Identifier

TTHERM_00532610

Standard Name

None

Aliases

PreTt19917 | 68.m00206 | 3830.m00571

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00532610

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11864.19.997093137033517e-262hypothetical protein (684 aa)
OxytrichaContig21285.0.g119.997093137033517e-262BOP1NT (NUC169) domain
SGDYMR049C1.000444791949842e-158ERB1 Constituent of 66S pre-ri
bosomal particles, forms a com
plex with Nop7p and Ytm1p that
is required for maturation of
the large ribosomal subunit;
required for maturation of the
25S and 5.8S ribosomal RNAs;
homologous to mammalian Bop1
DictyBaseDDB_G02818392.998986826334339e-156DDB_G0281839 on chromosome: 3
position 4997894 to 5000502
WormBaseWBGene000129781.99904246446894e-143Ribosome biogenesis protein BO
P1 homolog status:Confirmed
UniProt:Q9U2A9 protein_id:
CAB54439.1
Stentor CoeruleusSteCoe_55534.7111658015535965e-58

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00532610(coding)
ATGTCTTCAAAGTAGAATTTAAAGAGACCCCATAAGGTTTTAGATGAATTAGAGCAAAAA
AAGGACAGGCTTCTGATGTCTAACAAAAATTAGGATGAAGAAGATGAGAATGTCGATGAA
GTTGAAGATTAAAACAATAACCATTTAAAGGATGAATCTGAATCCGATGATACAGATGAT
GAAGAAATATTGGCAAAAATAGGTAGAGTTCCCTGGAAATGGTATGAAAACTATAAACAC
ATGGGTTATGATGCTGATATGAAGAAAGTTACCAAAAGAATTTAAGATGATAAAATTGAT
GAATTCATTAAGAAAGCTGAAGATCCTAACTGGTGGCGTACTATTCAAGATGAATTGAAT
TAGCGTGAAATCGTTTTGACTGATGAATAGTTAAAGTTACTTGAAAGAATTAGAAAAGGA
AAGTTTGCATCAAAAGCCATTGCAAGCAATGATTATACTGTTGAATATGAGTATGATGGA
ACCATGCCTCTTAGCAGTGCTCCCATACCAAAGAGAAGATTTATGCCCTCTAAAAATGAA
AGAATAAAAGTTAATAAACTCGTTTAAGCAATTTAGCTTGGTCGTATTGATCCTAAGAAA
TATTTAGAAGATTAAGAAAAAGAAGAAGAATAAGAAGAAATGCTTTTCGATATTTGGGAA
GGAACAAAAGATTAAGATGAAATTTAGAAAAAGCTTCCCCCTGCTATTTCAGCTCCTAAG
GTTAAACCTCCAGGTCATAATGAATCTTATAATCCTCCTAGTGAATACTTGATGTCAGAA
AAAGAGAAGAAGGAGTGGCAAAATGCACATCCTGAAGATAGAGAAATCCCTTTCATACCT
AAAAAATATGACTGTTTACGTCATGTTGAATTCTATCAAGGTTTAATTACAGAAAGATTT
GAAAGACAGCTTGATTTATATTTATGTCCTCGTATTCGTAAGAAAAAACTTGACATTGAT
CCTGAAACTTTAGTTCCCTCCATTCCCAAGCCATAAGAGCTTAGACCATATCCAACTAGT
CTTAATATTCAATACAAAGCCCACAAAGGAAGAGTTAGAGGTATTTCAGTTCTTTACGAT
GGTTAATTTATGGCTTCTTGTGATGAAAAGGGAGAGGTTATTGTTTGGGAAGTTAATACT
GCTAGAATAGTTTGGAGATAAGCATACAGAAGTATTTGCTACAGTGTTTAATTCTAACCA
TAAAAGGGTTTGTTAGTTGTAGCTAACGAAGATAAGATTTACATTTATAACATAAAAAAG
ATTCTCCCTAGCAATATTTATAAGCAAAACGAAGAAACTTTGGAAGAGTCAAAGAAGAGT
CACGAAGTTGAATATAACGCATAACTCAAATGGGTATTTACTGACCCTGAAAGTGAAGAA
TATAAAACAGGATTACGTGTTTCAATCAAATTCAGCAATGATGTTAAATAAATATCTTTC
CATTAAAATGGTGATTATTTCTCAACTCTCTCTCCAAGAGCCGAGAAGAGAAACGAATAA
ATCTTTATTCATTCTATTTCTAAGGGTAATTCATCAAAGCCATTCTCAAAGAGTAAGGGT
GATGTTGAAAAAGTAGCTTTCCATCCCAACAAACCAATCATATTTATCCTAACTAAAAAG
CACGTCTATGTCTATAACTTACAAAAACAAGCTACTCTTAAAAAGCTTCTTACAGGTTGC
TAATGGGCTTCAAGTATAGATATTCACCCTTATGGTGACAATCTCATAGTTGGTTCTTTT
GATAAAAAAGTACTTTGGTTTGATTTAGATTTAGGTAACACACCTTACAAAAACATGAAA
TATCACGAGAAAGGAATTAGACAAGTTTGCTTCTCTAGAAAATATCCTTTAATGGCTTCT
TCTTCAGATGATGGCAGTATTAATATTTTCCATGCTAAGGTATTCAAAGATTCCTTTGAA
AATGCTCTTATCCTCCCTGTAAAAGTACTTAAAGGTCATACTGTTCATAATAGTTTAGGT
GTTTTAGATATAGTATTCCATCCTACATAGCCTTGGATCTTCTCTGCAGGTTCTGATCAT
AGAATTTTCCTTTGGACATGA


>TTHERM_00532610(protein)
MSSKQNLKRPHKVLDELEQKKDRLLMSNKNQDEEDENVDEVEDQNNNHLKDESESDDTDD
EEILAKIGRVPWKWYENYKHMGYDADMKKVTKRIQDDKIDEFIKKAEDPNWWRTIQDELN
QREIVLTDEQLKLLERIRKGKFASKAIASNDYTVEYEYDGTMPLSSAPIPKRRFMPSKNE
RIKVNKLVQAIQLGRIDPKKYLEDQEKEEEQEEMLFDIWEGTKDQDEIQKKLPPAISAPK
VKPPGHNESYNPPSEYLMSEKEKKEWQNAHPEDREIPFIPKKYDCLRHVEFYQGLITERF
ERQLDLYLCPRIRKKKLDIDPETLVPSIPKPQELRPYPTSLNIQYKAHKGRVRGISVLYD
GQFMASCDEKGEVIVWEVNTARIVWRQAYRSICYSVQFQPQKGLLVVANEDKIYIYNIKK
ILPSNIYKQNEETLEESKKSHEVEYNAQLKWVFTDPESEEYKTGLRVSIKFSNDVKQISF
HQNGDYFSTLSPRAEKRNEQIFIHSISKGNSSKPFSKSKGDVEKVAFHPNKPIIFILTKK
HVYVYNLQKQATLKKLLTGCQWASSIDIHPYGDNLIVGSFDKKVLWFDLDLGNTPYKNMK
YHEKGIRQVCFSRKYPLMASSSDDGSINIFHAKVFKDSFENALILPVKVLKGHTVHNSLG
VLDIVFHPTQPWIFSAGSDHRIFLWT


>TTHERM_00532610(gene)
ATGTCTTCAAAGTAGAATTTAAAGAGACCCCATAAGGTTTTAGATGAATTAGAGCAAAAA
AAGGACAGGCTTCTGATGTCTAACAAAAATTAGGATGAAGAAGATGAGAATGTCGATGAA
GTTGAAGATTAAAACAATAACCATTTAAAGGATGAATCTGAATCCGATGATACAGATGAT
GAAGAAGTAATTTTGATATCTAATTATAAATTTTAAAAACAAAAGATCCATTTTTTCAAA
AATGTCTTGAAATATGAGCATAATTTAAGATATTCATATATTTTTTGATAGCTGATAAAA
AAATTAGAGTTATTACTAACTTAGTTTTCTCAATTTAAACTTTTTTTGTAACATAACAGA
TATTGGCAAAAATAGGTAGAGTTCCCTGGAAATGGTATGAAAACTATAAACACATGGGTT
ATGATGCTGATATGAAGAAAGTTACCAAAAGAATTTAAGGTAATATAAAAATTTCATGCA
TTAAAATTTTTTTCCTTCACTTTAATAGCTTTTATTCTTTACAATTAAATACATCCTCAA
AAGGAAAGGGATACTGAATTCAGCATTCATAATTTATAAAAAAGGCATAAAAGCCTAGAA
AATATATTTTAAATCTCTAATAGCTTATGTTTAAAAATAAAAAATTCTTAAATTAACTTA
AATAGATGATAAAATTGATGAATTCATTAAGAAAGCTGAAGATCCTAACTGGTGGCGTAC
TATTCAAGATGAATTGAATTAGCGTGAAATCGTTTTGACTGATGAATAGTTAAAGTTACT
TGAAAGAATTAGAAAAGGAAAGTTTGCATCAAAAGCCATTGCAAGCAATGATGTAATTTA
TCTGCTTATTACTAAAATAAATAAACTCAATATGTGTTTATTTCTTTGATACATTTAACT
TTAATGTTTTTACATTAAATATTTAGTATACTGTTGAATATGAGTATGATGGAACCATGC
CTCTTAGCAGTGCTCCCATACCAAAGAGAAGATTTATGCCCTCTAAAAATGAAAGAATAA
AAGTTAATAAACTCGTTTAAGCAATTTAGCTTGGTCGTATTGATCCTAAGAAATATTTAG
AAGATTAAGAAAAAGAAGAAGAATAAGAAGAAATGCTTTTCGATATTTGGGAAGGAACAA
AAGATTAAGATGAAATTTAGAAAAAGCTTCCCCCTGCTATTTCAGCTCCTAAGGTTAAAC
CTCCAGGTCATAATGAATCTTATAATCCTCCTAGTGAATACTTGATGTCAGAAGTAACCA
ATAAAATTAAAATAAAGATTTACATTTATTAATTAAATAAATATTTTAAAAACAGAAAGA
GAAGAAGGAGTGGCAAAATGCACATCCTGAAGATAGAGAAATCCCTTTCATACCTAAAAA
ATATGACTGTTTACGTCATGTTGAATTCTATCAAGGTTTAATTACAGAAAGATTTGAAAG
ACAGCTTGATTTATATTTATGTCCTCGTATTCGTAAGAAAAAACTTGACATTGATCCTGA
AACTTTAGTTCCCTCCATTCCCAAGCCATAAGAGCTTAGACCATATCCAACTAGTCTTAA
TATTCAATACAAAGCCCACAAAGGAAGAGTTAGAGGTATTTCAGTTCTTTACGATGGTTA
ATTTATGGCTTCTTGTGATGAAAAGGGAGAGGTAACTCTATTTTTTTTGAAATAAATAAA
ATTTACTAAACTTATTGATTAAAAATCTAGGTTATTGTTTGGGAAGTTAATACTGCTAGA
ATAGTTTGGAGATAAGCATACAGAAGTATTTGCTACAGTGTTTAATTCTAACCATAAAAG
GGTTTGTTAGTTGTAGCTAACGAAGATAAGATTTACATTTATAACATAAAAAAGATTCTC
CCTAGCAATATTTATAAGCAAAACGAAGAAACTTTGGAAGAGTCAAAGAAGAGTCACGAA
GTTGAATATAACGCATAACTCAAATGGGTATTTACTGACCCTGAAAGTGAAGAATATAAA
ACAGGATTACGTGTTTCAATCAAATTCAGCAATGATGTTAAATAAATATCTTTCCATTAA
AATGGTGATTATTTCTCAACTCTCTCTCCAAGAGCCGAGAAGAGAAACGAATAAATCTTT
ATTCATTCTATTTCTAAGGGTAATTCATCAAAGCCATTCTCAAAGAGTAAGGGTGATGTT
GAAAAAGTAGCTTTCCATCCCAACAAACCAATCATATTTATCCTAACTAAAAAGCACGTC
TATGTCTATAACTTACAAAAACAAGTAAAAATACTAAATTAAATTTCATCTTAATTAAAA
CATTAAATAAAAATAGAATAAAATTTTAATTTTAATTAAAAATATCCTCATTAAATATTT
CTTTTAATATCAATAGGCTACTCTTAAAAAGCTTCTTACAGGTTGCTAATGGGCTTCAAG
TATAGATATTCACCCTTATGGTGACAATCTCATAGTTGGTTCTTTTGATAAAAAAGTACT
TTGGTTTGATTTAGATTTAGGTAACACACCTTACAAAAACATGAAATATCACGAGAAAGG
AATTAGACAAGTTTGCTTCTCTAGAAAATATCCTTTAATGGCTTCTTCTTCAGATGATGG
TAAACTTATTAATTAATATGTTTGTTTTTAAAATATTAAATTTCAAATTATTAAATAGGC
AGTATTAATATTTTCCATGCTAAGGTATTCAAAGATTCCTTTGAAAATGCTCTTATCCTC
CCTGTAAAAGTACTTAAAGGTCATACTGTTCATAATAGTTTAGGTGTTTTAGATATAGTA
TTCCATCCTACATAGCCTTGGATCTTCTCTGCAGGTTCTGATCATAGAATTTTCCTTTGG
ACATGA