Identifiers and Description

Gene Model Identifier

TTHERM_00532180

Standard Name

None

Aliases

PreTt19876 | 68.m00165 | 3830.m00530

Description

Kelch motif family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00532180

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11823.19.997093137033517e-262kelch domain-containing protei
n family protein (563 aa)
OxytrichaContig18792.0.g357.000846320060671e-65Galactose oxidase, central dom
ain
WormBaseWBGene000099781.0004572433669413e-23status:Confirmed UniProt:G5E
BG8 protein_id:CAN86636.1
Stentor CoeruleusSteCoe_335742.8625185805493937e-20
DictyBaseDDB_G02826672.99851380290819e-19DDB_G0282667 on chromosome: 3
position 6096363 to 6098133
SGDYHR158C8.997498379799854e-17KEL1 Protein required for prop
er cell fusion and cell morpho
logy; functions in a complex w
ith Kel2p to negatively regula
te mitotic exit, interacts wit
h Tem1p and Lte1p; localizes t
o regions of polarized growth;
potential Cdc28p substrate

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00532180(coding)
ATGAAAAAATAGCAAAATAGAGTAGACTCTGCTCACTTCAGAGAAGGTGAAAGAAATAAA
TCTGTAGATAATAACTCTGAATATAGCAAAGCAAAATATGCTGATTAGCCTATCTAATAA
TTATAATAAAATTTAGATACAAAGTGGAGCGAAATTAAAATATTTAATAAAAATATTTGT
CGCAGAAGCTATCACTCTGGAGTCAGTCATGAAGATAGGATGTACATTTATGGTGGATAT
GAAGTAAATGAAGGAATATTGGGAGATTTTTATGAAATGATGATTAAAAATAATTAAGTA
TTTTAATGGTAAAAAGTTAATTTGTCAAAGTATGGACCTAATAATGATAAACCCTTAACT
CCTGGTCCTTTGATGAGACATACAGCTGTAACTTACAAAGATAAAATGTACATTTACGGA
GGTAATTAGCAATCTTTAAAGCCTTCTAGTTAACTTTGGTCATTTGACTTTAATGAAGAC
GAGTGGCAAATAGTTAAGCCTAACGGAGAGCAGGCTCCTCCTTCATTAGATTCTCATGCT
GCCGCAGTAGATGAAATAAATCATGCTATGTATATTTTTGGTGGTTTTTCTGATAGCCAA
AAAGATGGAGGTTACTAAAATAAGGTTTGGAAATTTAGTTTTGAGAGTCAATAATGGGAT
TTATTGGGTGAGAACTCTGAAACTAAACCATGTAAGCGTGCTGGATCAAGTATCACACTC
TATGATAATATTTTGTATATGTTTGGAGGGACTATAGTTGATGCAAAGTATAATGATATG
TGGTCTTTTGATTTATAAACATAATAATGGGAGCATATTAAGTAAGAAAAAGAAGATTTA
GTACCCGAAACTAGAAATGGACATTCTCTCCTAACTTATAAAGATAAATTAATTTTATTT
GGAGGTATTCATGATATTACTCATGAAAAGAATGACATGTATGTTTTTAATGTGAGAACT
AAAAAATGGAGTTTAATTGATGACAATACTTCACATAATTAAAGCAGTTTGAATGATGAT
ATCTTAGCAATTGAATAAAGCTTTTCAAATGGATTTTAAAATGAACAATCATTTAAAGAT
TAAAACAAGAAAATCCATTCTGAAGTTAACTAGCAAAGCCATAATGTTCGTACTAAAACT
AAAAATTCTTCTTTAGAACGAATTAAAGCAACAAATAGTGAAAAGCATAATCTATCAAAT
AGTTCTCGCATAATAAAACAAAGTATGAAAAAATAAAATGACAGCATTGGCTCAAAAGAA
GAATCGCACACTGTCAATAATTAGATGGAAGAAAATAGAAAAAAAAGAATCTAAATGAAA
AAAATGAATTTACTTTCTGAATTTGAATTAAACGAATCAGAAAAGAGTATAATCAGACCA
GTAAGTCCTACTACAGAAAATATGAAGAATAGTATATAAACAGTTGGTAATCCCTTAGGT
AAAACAAAGTATTCACTAAGAATTCTAGATAGCTCCTTGACTAGAACATAGCTTGGAGGA
AATAGTGAGCAAAGATAAAATAAAATGATAGGTAGACGCCCTTGTGCAAGAGATGGTCAT
TCTGCTGTGATTTGTGATAATTTTTGCTATATTTTTGGAGGTGATCGTCATATGATGTCA
TATAATGATTTATTTTGTGTTGATTTAGATAAAATAATGGAATCTTTGTCTTGA


>TTHERM_00532180(protein)
MKKQQNRVDSAHFREGERNKSVDNNSEYSKAKYADQPIQQLQQNLDTKWSEIKIFNKNIC
RRSYHSGVSHEDRMYIYGGYEVNEGILGDFYEMMIKNNQVFQWQKVNLSKYGPNNDKPLT
PGPLMRHTAVTYKDKMYIYGGNQQSLKPSSQLWSFDFNEDEWQIVKPNGEQAPPSLDSHA
AAVDEINHAMYIFGGFSDSQKDGGYQNKVWKFSFESQQWDLLGENSETKPCKRAGSSITL
YDNILYMFGGTIVDAKYNDMWSFDLQTQQWEHIKQEKEDLVPETRNGHSLLTYKDKLILF
GGIHDITHEKNDMYVFNVRTKKWSLIDDNTSHNQSSLNDDILAIEQSFSNGFQNEQSFKD
QNKKIHSEVNQQSHNVRTKTKNSSLERIKATNSEKHNLSNSSRIIKQSMKKQNDSIGSKE
ESHTVNNQMEENRKKRIQMKKMNLLSEFELNESEKSIIRPVSPTTENMKNSIQTVGNPLG
KTKYSLRILDSSLTRTQLGGNSEQRQNKMIGRRPCARDGHSAVICDNFCYIFGGDRHMMS
YNDLFCVDLDKIMESLS


>TTHERM_00532180(gene)
ATGAAAAAATAGCAAAATAGAGTAGACTCTGCTCACTTCAGAGAAGGTGAAAGAAATAAA
TCTGTAGATAATAACTCTGAATATAGCAAAGCAAAATATGCTGATTAGCCTATCTAATAA
TTATAATAAAATTTAGATACAAAGTGGAGCGAAATTAAAATATTTAATAAAAATATTTGT
CGCAGAAGCTATCACTCTGGAGTCAGTCATGAAGATAGGTATTTATTTATAAATGGTTTT
CTTTATTTTTTAAGTAAATGCTTTGAGGTATTGAATGAATGCTTCTTTTTATTGATAATA
TAAAGTTAAGTAAAAAATATCTATTTCTATATTTAATACGATAGGATGTACATTTATGGT
GGATATGAAGTAAATGAAGGAATATTGGGAGATTTTTATGAAATGATGATTAAAAATAAT
TAAGTATTTTAATGGTAAAAAGTTAATTTGTCAAAGTATGGACCTAATAATGATAAACCC
TTAACTCCTGGTCCTTTGATGAGACATACAGCTGTAACTTACAAAGATAAAATGTACATT
TACGGAGGTAATTAGCAATCTTTAAAGCCTTCTAGTTAACTTTGGTCATTTGACTTTAAT
GAAGACGAGTGGCAAATAGTTAAGCCTAACGTAAATATTTAGCTGCTTTTAATAAAATTT
AAATAAATAAATTCTATATTTTTTAAGGGAGAGCAGGCTCCTCCTTCATTAGATTCTCAT
GCTGCCGCAGTAGATGAAATAAATCATGCTATGTATATTTTTGGTGGTTTTTCTGATAGC
CAAAAAGATGGAGGTTACTAAAATAAGGTTTGGAAATTTAGTTTTGAGAGTCAATAATGG
GATTTATTGGGTGAGAACTCTGAAACTAAACCATGTAAGCGTGCTGGATCAAGTATCACA
CTCTATGATAATATTTTGTATATGTTTGGAGGTAAAGTACCTTTTTTTATTACTTAAAGC
GAAAATAATTTTAATTAAATAACTCACAGGGACTATAGTTGATGCAAAGTATAATGATAT
GTGGTCTTTTGATTTATAAACATAATAATGGGAGCATATTAAGTAAGAAAAAGAAGATTT
AGTACCCGAAGTAATAAATTAATAGTAAACAAATATTATAAAATAAAGCATTTTATTTAT
ATAAATAGACTAGAAATGGACATTCTCTCCTAACTTATAAAGATAAATTAATTTTATTTG
GAGGTATTCATGATATTACTCATGAAAAGAATGACATGTATGTTTTTAATGTGAGAACTA
AAAAATGGAGTTTAAGTATTTATTTTTAATTTATTTAATTAAATTGTATGAAAATATTTT
TTTTTTAAAGTTGATGACAATACTTCACATAATTAAAGCAGTTTGAATGATGATATCTTA
GCAATTGAATAAAGCTTTTCAAATGGATTTTAAAATGAACAATCATTTAAAGATTAAAAC
AAGAAAATCCATTCTGAAGTTAACTAGCAAAGCCATAATGTTCGTACTAAAACTAAAAAT
TCTTCTTTAGAACGAATTAAAGCAACAAATAGTGAAAAGCATAATCTATCAAATAGTTCT
CGCATAATAAAACAAAGTATGAAAAAATAAAATGACAGCATTGGCTCAAAAGAAGAATCG
CACACTGTCAATAATTAGATGGAAGAAAATAGAAAAAAAAGAATCTAAATGAAAAAAATG
AATTTACTTTCTGAATTTGAATTAAACGAATCAGAAAAGAGTATAATCAGGTAAAAAAAT
TCAATTTTCTATAAAATAATTTTGATAACGATTATTTATAATATACTGTGTTGCTTTCCA
AGTGTTTTTTTAAGAATTATAAAAATTTTACAAATACTCAAAGTTTCAGATAAAAATGTA
AGCTTAATTGAAAAGTTAAGTTGATATTGCTTCTTATTTTATTAAAATAAATTAAATTGT
GTAAACTTTAAATTTAATCTTTATTTATACTTAAATAGACCAGTAAGTCCTACTACAGAA
AATATGAAGAATAGTATATAAACAGTTGGTAATCCCTTAGGTAAAACAAAGTATTCACTA
AGAATTCTAGATAGCTCCTTGACTAGAACATAGCTTGGAGGAAATAGTGAGCAAAGATAA
AATAAAATGATAGGTAGACGCCCTTGTGCAAGAGATGGTCATTCTGCTGTGATTTGTGAT
AATTTTTGCTATATTTTTGGAGGTGATCGTCATATGATGTCATATAATGATTTATTTTGT
GTTGATTTAGATAAAATAATGGAATCTTTGTCTTGA