Identifiers and Description

Gene Model Identifier

TTHERM_00532040

Standard Name

None

Aliases

PreTt19862 | 68.m00151 | 3830.m00514

Description

ATPase histidine kinase- DNA gyrase B

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( TIGR01386 ) heavy metal sensor kinase
  • ( PF00072 ) response regulator receiver domain
  • ( TIGR02956 ) TMAO reductase sytem sensor TorS
  • ( PF00512 ) His Kinase A (phosphoacceptor) domain
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)
  • ( TIGR02966 ) phosphate regulon sensor kinase PhoR
  • ( TIGR00255 ) conserved hypothetical protein TIGR00255
  • ( PF02518 ) ATPase, histidine kinase-, DNA gyrase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 28.4%

TetraMine Data

TTHERM_00532040

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11807.12.999784173812224e-165hsp90-like protein (1244 aa)
OxytrichaContig7986.0.g1001.999534248571833e-46Histidine kinase-, DNA gyrase
B-, and HSP90-like ATPase
DictyBaseDDB_G02778875.000574419929632e-30dhkK on chromosome: 3 position
942210 to 945957
Stentor CoeruleusSteCoe_63625.74952226429356e-19
SGDYIL147C0.0000000000000299873730555305SLN1 Histidine kinase osmosens
or that regulates a MAP kinase
cascade; transmembrane protei
n with an intracellular kinase
domain that signals to Ypd1p
and Ssk1p, thereby forming a p
hosphorelay system similar to
bacterial two-component regula
tors

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00532040(coding)
ATGCTTTTTTAACAAAAATTATGCTTGATTGTTTGGAATTTAGAATAAGCATATAATAAG
TAAAATAAGAATAAACAAACAAGATCTTATTTCTAACTTAATTGTTAAAAATAAACATTA
TATATAGCAGAAATCTCTCAGAGTTACTTTCTGAGAAAATAGTTTGAATCATAAAACAAT
TAAATAGACTGCGTATAGACAAACTCCTTAAGTTATTATTAAATATAAAATTCGATAGAA
TCGCTTTTTATAAAAGACATATTAGCTAATCTTTAAGAAATGCAATAGATTAAATCATAA
ATAAAGCAAGTGGAATCAGCTAGGGAATTTGTATATTGTGCAAATTTATAAAATATACTT
ACTTTGCATAATTAAGGAGTTAATAAAAACATATACTAAGGTGTTATTGTTCTTTTTGTA
GTGCTCATTTTTGATTTGCTCAATCTTTCTATAAATTATAGCAGCTTTGGAAAGTCATTG
CTTCTCATTTTAATCTTTAAATTAAGTCTACTTGTTGCATTTTTAATGGCGTGGAATAGT
AAATCGTACTAAAAACTTAATCTTAATACAAAGAAAGTGATTCTGTTTATATATTCGATA
ATATTGATGGTTATTTTCGCTGAAGAAATAATTTTAAAGGAGAATAGTTAAAACTAAAAA
AACATAATCATTATTGGTTTAATACAGATCTTCATTATTATAATTATATTTTGGCAATTA
TACTAAGATAACAATCTGGTAATCGTAATTATTTGTTTGACAGCTGCATATTTTTTAGCA
AGGTTATTTTATTACGACACTCAAAATCCGGTAGAAATAGTTTTTGGCATTTTACAATTT
TTGTCATTAGTAGCATATATAAGCTTTAGAATGCATAATTAAATATTACTAAATTAAATT
AAAGCAGAAGGATGTAATTACATTAGCACTTAGAGATTTTTATAAAATAATATGGATGTA
AATTAATCACAGATATAAAGGAGTAAAATAAAAAATGAGTAAAATTGTGACATATTTAAT
GATACTCTAAATATACATCCAAGCTAGATAAACCTTAAATAGTAAAAATAATACAGCAAT
AATTAATCACATATTTAAAACTAACTAGATTAGTCTGGAATGAATTCACATTAAAAAGAT
AAGGGTTTTTCATTTTCGTTTGATCTATAAGGAAGAGAACCACAAACTCCACTTTAGTAA
TAGTTAGTATAAGAAAATTAAGCTAACAGCTAAATACATAAATACTAATTAAATGGGAGT
TATTAATACGAAAAAGAGAGTGAATTAGCTCTTAAAAGTACTAGTAATAACAGTTAAAAA
TAAAATATAAGACCAACTATTCGAGACTAGTCCAATAGTGTTTAAAAAGCTAATTCTGAA
TCATAATAAAAGCTAAATGGATATGGAGAATTTAGCATAAATAATTTTTAAAGCAATGAG
TAAATTTAGCAGGGATAGAAACAATAATTTAAATCTTAAATTGCCTGTTAAGCGTCAATT
TAAGCTTCACCTGTTTTTAACATGTCATAAGGTGGTTAAAATCAATATGGGTCTTAGCAG
TAATTAGAATCCTCAAAAAATATAAGTCTTGCACACTTAGAAACTGTCTATACCAAAAAG
AATCATACTGGAAAATCTATGAATTCTGAAACAGTTAATTTGGTTAATTTTTACAATATG
TTTTTCAACATACTGCCTTAGGGAATAGCAATCATTCCTCTTTCAAATTTTCCTGAGAGT
TTGGAAGGATGCCAAATAAATTAAACTCTTAGCTCCTTATTAGAATGCGACAATAAAGAA
GTATGTATATAAATGCTTACAGAGCTAAAGAACTCGAAGCTAGAGGAGCAGTTAGCATAG
ATAAATAGCAATGTAAATGTACCTAATTTGGGTAGCAGTGGTTCCTATATGCATTAAGAA
TTTGCAGCATTCAAAAGTGATTCAATAGTCAGTTCAACAAGCATAAACAACCAACAGCAG
TAAGAACCTTTAAAAACAAAAAAAACAAATTAATTATTATCAACTCACAGCCTGAAGGAA
GATGCCCATAACATATTATTAGATAATATAAATTTAGAAGAAGCAAGTGAAAATTATATA
AATGAAAAAACCAGGCGTATCACATTTGTGATAGATTATAATGGCTTAAAAAGAAATAAA
AACATTTCAAGTCATAGCGAAATTGTTTAGAATTAAAGGAAATTTTCATTAAATGAGTCA
AGGAGTAATAGATTCTACTCTAATGTTAATCAAGAAGATTCTAAAGGCAATTAGAATGGA
GATAATTAAAGTGTTAAAGGACTACCTCTTTTAAAACCTAGCAACTACTAAGTTTAAGTG
AATTCCTCAACTAAAATGTCTGTAAAGCTCGAGATAGAACATATTAAAAAATAAATTCAA
AATTTAAAGTTCTTTGATAGCTATGAAATGATTGGAGTGCATGTGAGAATGGTTTCAAAA
TGTTAATTAAATAGCTAAAAAACTAAATATTTCGAAATAATATTTATACCATGCATTGTT
AAATCTGAAATTACAGTTGTACTTGTTGTCAAAGATATCACCCACTTTAATGAAATTGAA
GTTTTAAAGATGGTAAATGAAAATAAAAGCTAAATGTTATCTTAAGTGGCTCATGAAATA
AGAACACCTTTAAATTGTGTGATAAGTATGATAGAAATAACCAAAGATTTAGCAGAGTAG
TCTGTGTGTGAAAATTTTTTAGCACCTGCATTAACAAGTGCTCGTTTACTGAATAATTTA
ATATAAGATTTATTAGACATGGCATAAGTAAAAGCCGGCTGCTTTTAACTTAAATCTACA
AAATTTAACATTAGAAATTTGTTAGAGGAGGTTAAGTAATTGATGAAAGTGTAAGTGCAA
AGCTCTAATATATAAATGGAAATTTCAATTAGCGATTAAGTGCCAACGTTTATATACTCT
GATCCTTTTCGAATAAGATAAATACTAATAAATCTTATAGGCAACGCTCTTAAATTTACT
TAGAAAGGATTTATTACAGTCGTAGCTGAAAGGTACACATATTAAAATATTGACACCATA
GTTAGAATATCAGTAAAAGATACAGGTATTGGTATTAAGCCAAAGTAAAAGTAAAAATTA
TTTCAAGCTTTTGGAAAGTTAGACGATGATAACTAAGAATACCTTAATCCTAAGGGAGTT
GGTTTAGGACTTATGATTTCAAATGAATTAGCTAAAAAATTGAGCAATCCTATATTTACA
AACTAGGGATTAGAGGTAGAATCTGTTTATGGATAAGGATCATAATTTTCTTTTTTTATT
ATTGATAATGTCTAGCTTCAAGCTTCGGTACTATAAGTCTCTTAAAAATAGATATAAATA
TATGATGCAAAAACAGAAAGAACTATTGGTATCAAAAAAAAGGTAGATTAAAGTTCTTTA
CATAGAATAGATGAAGAGGACAGAGAAGTAAAGAGTCAGAATGAAATTTTCCTTGAAAAT
AGTGGAATACATTTGTCAAAACAAAATAATCCATCAATCTAAAATTATTAAATGTCTAAT
ACTTTATAAGCAATTTCAAACAATTCTAATTAATGGAACTAGAGCACAAGTATTATATAT
GCCTAAAACCATGATTAAAACTAGAAATAGCTAAATAGCAGCTTAAATAATTAACTAACA
CATGACATAAATCATTAGTAAAACAACATGAAAAAAGGTTCATCTCTCAACCCTGCATAA
GAACCAAATAAAGTAGTTCATTCACATAACAGTTTTGATCACAATATAGAAGATGAAGAG
AGTAGAATAAACCCGATAAATAGCTAGTAATATAATAAACAAGATGAATCAAATTTAGCT
CCTCATTTTAATGATAATAAATTAATAAACAAGTCTTTTACACCATAACCTCATAATTCA
AATATGAGCACTAATGACTACAATTACGATGCTGTTGATTATGATTCTCAATATTAAAAA
TAGTAAAACAATTCCTAATTTTCAAATAAATTACAAAACTAGGTATCACAATAAAAAATA
AATATATAATCATTAATCCCACATAGTGGTCCTTCATTGTAATCTCCAAATATTAACTCT
GTTTAAACAAAGAGAATGAGTATCCATAAACAATTTTTTATCAAGTAATATGAGGAACTT
GAAAATCAGTTTGGTTCTGTTGTTAATCCTCTTGAAACTAAGGAGTTTGGTTCTGTTATA
TCTTCTTAGCTAGAAGAATAGCAAGCAACAAACAGTAAAACTGAAAAAATAGTTTGTTAA
TGCAAAAAAATACTTATAGTTGATGATAATACATTTAATGTCTATGCTCTTTAGTAATTA
ATTAAAACATTAAAGTAGGTAGAATGTGATACTTCATTGAGTGGAGAATTAGCAATTGAA
CTCATTAAATAAAAATTAACAAAAAACTGTTGTCAGTCTTATAAAATAATATTCATGGAT
ATTGACATGCCTTAACAAAGTGGTTTAGAAACTACGAGAATAATAAGATAAAATTTTTTG
AGCTCAAAAGAAACTATGATAATTGGGTGCTCAGGCTATTCAAATTCTTAAGAATATCAA
AATTGTATAGAAGCTGGAATGAATGATTATCTGTCAAAACCTATTGATAAAAATCTTCTT
AAAGATATGTTAGAAAATTTTTTGTGA


>TTHERM_00532040(protein)
MLFQQKLCLIVWNLEQAYNKQNKNKQTRSYFQLNCQKQTLYIAEISQSYFLRKQFESQNN
QIDCVQTNSLSYYQIQNSIESLFIKDILANLQEMQQIKSQIKQVESAREFVYCANLQNIL
TLHNQGVNKNIYQGVIVLFVVLIFDLLNLSINYSSFGKSLLLILIFKLSLLVAFLMAWNS
KSYQKLNLNTKKVILFIYSIILMVIFAEEIILKENSQNQKNIIIIGLIQIFIIIIIFWQL
YQDNNLVIVIICLTAAYFLARLFYYDTQNPVEIVFGILQFLSLVAYISFRMHNQILLNQI
KAEGCNYISTQRFLQNNMDVNQSQIQRSKIKNEQNCDIFNDTLNIHPSQINLKQQKQYSN
NQSHIQNQLDQSGMNSHQKDKGFSFSFDLQGREPQTPLQQQLVQENQANSQIHKYQLNGS
YQYEKESELALKSTSNNSQKQNIRPTIRDQSNSVQKANSESQQKLNGYGEFSINNFQSNE
QIQQGQKQQFKSQIACQASIQASPVFNMSQGGQNQYGSQQQLESSKNISLAHLETVYTKK
NHTGKSMNSETVNLVNFYNMFFNILPQGIAIIPLSNFPESLEGCQINQTLSSLLECDNKE
VCIQMLTELKNSKLEEQLAQINSNVNVPNLGSSGSYMHQEFAAFKSDSIVSSTSINNQQQ
QEPLKTKKTNQLLSTHSLKEDAHNILLDNINLEEASENYINEKTRRITFVIDYNGLKRNK
NISSHSEIVQNQRKFSLNESRSNRFYSNVNQEDSKGNQNGDNQSVKGLPLLKPSNYQVQV
NSSTKMSVKLEIEHIKKQIQNLKFFDSYEMIGVHVRMVSKCQLNSQKTKYFEIIFIPCIV
KSEITVVLVVKDITHFNEIEVLKMVNENKSQMLSQVAHEIRTPLNCVISMIEITKDLAEQ
SVCENFLAPALTSARLLNNLIQDLLDMAQVKAGCFQLKSTKFNIRNLLEEVKQLMKVQVQ
SSNIQMEISISDQVPTFIYSDPFRIRQILINLIGNALKFTQKGFITVVAERYTYQNIDTI
VRISVKDTGIGIKPKQKQKLFQAFGKLDDDNQEYLNPKGVGLGLMISNELAKKLSNPIFT
NQGLEVESVYGQGSQFSFFIIDNVQLQASVLQVSQKQIQIYDAKTERTIGIKKKVDQSSL
HRIDEEDREVKSQNEIFLENSGIHLSKQNNPSIQNYQMSNTLQAISNNSNQWNQSTSIIY
AQNHDQNQKQLNSSLNNQLTHDINHQQNNMKKGSSLNPAQEPNKVVHSHNSFDHNIEDEE
SRINPINSQQYNKQDESNLAPHFNDNKLINKSFTPQPHNSNMSTNDYNYDAVDYDSQYQK
QQNNSQFSNKLQNQVSQQKINIQSLIPHSGPSLQSPNINSVQTKRMSIHKQFFIKQYEEL
ENQFGSVVNPLETKEFGSVISSQLEEQQATNSKTEKIVCQCKKILIVDDNTFNVYALQQL
IKTLKQVECDTSLSGELAIELIKQKLTKNCCQSYKIIFMDIDMPQQSGLETTRIIRQNFL
SSKETMIIGCSGYSNSQEYQNCIEAGMNDYLSKPIDKNLLKDMLENFL


>TTHERM_00532040(gene)
ATGCTTTTTTAACAAAAATTATGCTTGATTGTTTGGAATTTAGAATAAGCATATAATAAG
TAAAATAAGAATAAACAAACAAGATCTTATTTCTAACTTAATTGTTAAAAATAAACATTA
TATATAGCAGAAATCTCTCAGAGTTACTTTCTGAGAAAATAGTTTGAATCATAAAACAAT
TAAATAGACTGCGTATAGACAAACTCCTTAAGTTATTATTAAATATAAAATTCGATAGAA
TCGCTTTTTATAAAAGACATATTAGCTAATCTTTAAGAAATGCAATAGATTAAATCATAA
ATAAAGCAAGTGGAATCAGCTAGGGAATTTGTATATTGTGCAAATTTATAAAATATACTT
ACTTTGCATAATTAAGGAGTTAATAAAAACATATACTAAGGTGTTATTGTTCTTTTTGTA
GTGCTCATTTTTGATTTGCTCAATCTTTCTATAAATTATAGCAGCTTTGGAAAGTCATTG
CTTCTCATTTTAATCTTTAAATTAAGTCTACTTGTTGCATTTTTAATGGCGTGGAATAGT
AAATCGTACTAAAAACTTAATCTTAATACAAAGAAAGTGATTCTGTTTATATATTCGATA
ATATTGATGGTTATTTTCGCTGAAGAAATAATTTTAAAGGAGAATAGTTAAAACTAAAAA
AACATAATCATTATTGGTTTAATACAGATCTTCATTATTATAATTATATTTTGGCAATTA
TACTAAGATAACAATCTGGTAATCGTAATTATTTGTTTGACAGCTGCATATTTTTTAGCA
AGGTTATTTTATTACGACACTCAAAATCCGGTAGAAATAGTTTTTGGCATTTTACAATTT
TTGTCATTAGTAGCATATATAAGCTTTAGAATGCATAATTAAATATTACTAAATTAAATT
AAAGCAGAAGGATGTAATTACATTAGCACTTAGAGATTTTTATAAAATAATATGGATGTA
AATTAATCACAGATATAAAGGAGTAAAATAAAAAATGAGTAAAATTGTGACATATTTAAT
GATACTCTAAATATACATCCAAGCTAGATAAACCTTAAATAGTAAAAATAATACAGCAAT
AATTAATCACATATTTAAAACTAACTAGATTAGTCTGGAATGAATTCACATTAAAAAGAT
AAGGGTTTTTCATTTTCGTTTGATCTATAAGGAAGAGAACCACAAACTCCACTTTAGTAA
TAGTTAGTATAAGAAAATTAAGCTAACAGCTAAATACATAAATACTAATTAAATGGGAGT
TATTAATACGAAAAAGAGAGTGAATTAGCTCTTAAAAGTACTAGTAATAACAGTTAAAAA
TAAAATATAAGACCAACTATTCGAGACTAGTCCAATAGTGTTTAAAAAGCTAATTCTGAA
TCATAATAAAAGCTAAATGGATATGGAGAATTTAGCATAAATAATTTTTAAAGCAATGAG
TAAATTTAGCAGGGATAGAAACAATAATTTAAATCTTAAATTGCCTGTTAAGCGTCAATT
TAAGCTTCACCTGTTTTTAACATGTCATAAGGTGGTTAAAATCAATATGGGTCTTAGCAG
TAATTAGAATCCTCAAAAAATATAAGTCTTGCACACTTAGAAACTGTCTATACCAAAAAG
AATCATACTGGAAAATCTATGAATTCTGAAACAGTTAATTTGGTTAATTTTTACAATATG
TTTTTCAACATACTGCCTTAGGGAATAGCAATCATTCCTCTTTCAAATTTTCCTGAGAGT
TTGGAAGTAATTTTTATTGAATTAATAAAATATTAAACTAAGAAGATAAATTTAAGAAAA
ATATAGATTTAAGTTTTCATTTTTTATAGAATTTATTTCTTTTTAAAAATTTAGGGATGC
CAAATAAATTAAACTCTTAGCTCCTTATTAGAATGCGACAATAAAGAAGTATGTATATAA
ATGCTTACAGAGCTAAAGAACTCGAAGCTAGAGGAGCAGTTAGCATAGATAAATAGCAAT
GTAAATGTACCTAATTTGGGTAGCAGTGGTTCCTATATGCATTAAGAATTTGCAGCATTC
AAAAGTGATTCAATAGTCAGTTCAACAAGCATAAACAACCAACAGCAGTAAGAACCTTTA
AAAACAAAAAAAACAAATTAATTATTATCAACTCACAGCCTGAAGGAAGATGCCCATAAC
ATATTATTAGATAATATAAATTTAGAAGAAGCAAGTGAAAATTATATAAATGAAAAAACC
AGGCGTATCACATTTGTGATAGATTATAATGGCTTAAAAAGAAATAAAAACATTTCAAGT
CATAGCGAAATTGTTTAGAATTAAAGGAAATTTTCATTAAATGAGTCAAGGAGTAATAGA
TTCTACTCTAATGTTAATCAAGAAGATTCTAAAGGCAATTAGAATGGAGATAATTAAAGT
GTTAAAGGACTACCTCTTTTAAAACCTAGCAACTACTAAGTTTAAGTGGTAAGTTATAAA
AATCAAAATGTTTAAATTTACTTACTAACATTTCTTTTAACTATCAAATAAGAATTCCTC
AACTAAAATGTCTGTAAAGCTCGAGATAGAACATATTAAAGTAATTTATTTGGCTAAATA
ATCAATTTATTTAATCTTTATTTTTGTTAATATTTAGAAATAAATTCAAAATTTAAAGTT
CTTTGATAGCTATGAAATGATTGGAGTGCATGTGAGAATGGTTTCAAAATGTTAATTAAA
TAGCTAAAAAACTAAATATTTCGAAATAATATTTATACCATGCATTGTTAAATCTGAAAT
TACAGTTGTACTTGTTGTCAAAGATATCACCCACTTTAATGAAATTGAAGTTTTAAAGGT
AATTAATATAATTCAATAAATATTATTTATTGCTAGCTTAATAATAATTCTATGTAAATA
GATGGTAAATGAAAATAAAAGCTAAATGTTATCTTAAGTGGCTCATGAAATAAGAACACC
TTTAAATTGTGTGATAAGTATGATAGAAATAACCAAAGATTTAGCAGAGTAGTCTGTGTG
TGAAAATTTTTTAGCACCTGCATTAACAAGTGCTCGTTTACTGAATAATTTAATATAAGA
TTTATTAGACATGGCATAAGTAAAAGCCGGCTGCTTTTAACTTAAATCTACAAAATTTAA
CATTAGAAATTTGTTAGAGGAGGTTAAGTAATTGATGAAAGTGTAAGTGCAAAGCTCTAA
TATATAAATGGAAATTTCAATTAGCGATTAAGTGCCAACGTTTATATACTCTGATCCTTT
TCGAATAAGATAAATACTAATAAATCTTATAGGCAACGCTCTTAAATTTACTTAGAAAGG
ATTTATTACAGTCGTAGCTGAAAGGTACACATATTAAAATATTGACACCATAGTTAGAAT
ATCAGTAAAAGATACAGGTATTGGTATTAAGCCAAAGTAAAAGTAAAAATTATTTCAAGC
TTTTGGAAAGTTAGACGATGATAACTAAGAATACCTTAATCCTAAGGGAGTTGGTTTAGG
ACTTATGATTTCAAATGAATTAGCTAAAAAATTGAGCAATCCTATATTTACGTAAGAAAA
AATTCTAATAATTAAATTAATTTCAAATAAAAAACTGAATAAATGCTCTCATAAAATTAA
AATTTCATTGAAAAAGAAAAAAATTTTAAATTAAATACAATTTTTTTTGATATTTAACAA
AATAAATAAAAACTTTAAATGAAATTAAAAAAAGATATGCTTAAACCAATTTTATTTCAA
TCAATCTGTATAAACTTTTGAATGTAATTACCAAAATATTATTAATAAATTTTTATTATA
CTTAGAAACTAGGGATTAGAGGTAGAATCTGTTTATGGATAAGGATCATAATTTTCTTTT
TTTATTATTGATAATGTCTAGCTTCAAGCTTCGGTACTATAAGTCTCTTAAAAATAGATA
TAAATATATGATGCAAAAACAGAAAGAACTATTGGTATCAAAAAAAAGGTAGATTAAAGT
TCTTTACATAGAATAGATGAAGAGGACAGAGAAGTAAAGAGTCAGAATGAAATTTTCCTT
GAAAATAGTGGAATACATTTGTCAAAACAAAATAATCCATCAATCTAAAATTATTAAATG
TCTAATACTTTATAAGCAATTTCAAACAATTCTAATTAATGGAACTAGAGCACAAGTATT
ATATATGCCTAAAACCATGATTAAAACTAGAAATAGCTAAATAGCAGCTTAAATAATTAA
CTAACACATGACATAAATCATTAGTAAAACAACATGAAAAAAGGTTCATCTCTCAACCCT
GCATAAGAACCAAATAAAGTAGTTCATTCACATAACAGTTTTGATCACAATATAGAAGAT
GAAGAGAGTAGAATAAACCCGATAAATAGCTAGTAATATAATAAACAAGATGAATCAAAT
TTAGCTCCTCATTTTAATGATAATAAATTAATAAACAAGTCTTTTACACCATAACCTCAT
AATTCAAATATGAGCACTAATGACTACAATTACGATGCTGTTGATTATGATTCTCAATAT
TAAAAATAGTAAAACAATTCCTAATTTTCAAATAAATTACAAAACTAGGTATCACAATAA
AAAATAAATATATAATCATTAATCCCACATAGTGGTCCTTCATTGTAATCTCCAAATATT
AACTCTGTTTAAACAAAGAGAATGAGTATCCATAAACAATTTTTTATCAAGTAATATGAG
GAACTTGAAAATCAGTTTGGTTCTGTTGTTAATCCTCTTGAAACTAAGGAGTTTGGTTCT
GTTATATCTTCTTAGCTAGAAGAATAGCAAGCAACAAACAGTAAAACTGAAAAAATAGTT
TGTTAATGCAAAAAAATACTTATAGTTGATGATAATACATTTAATGTCTATGCTCTTTAG
TAATTAATTAAAACATTAAAGTAGGTAGAATGTGATACTTCATTGAGTGGAGAATTAGCA
ATTGAACTCATTAAATAAAAATTAACAAAAAACTGTTGTCAGTCTTATAAAATAATATTC
ATGGATATTGACATGCCTTAACAAAGTGGTTTAGAAACTACGAGAATAATAAGATAAAAT
TTTTTGAGCTCAAAAGAAACTATGATAATTGGGTGCTCAGGCTATTCAAATTCTTAAGAA
TATCAAAATTGTATAGAAGCTGGAATGAATGATTATCTGTCAAAACCTATTGATAAAAAT
CTTCTTAAAGATATGTTAGAAAATTTTTTGTGA