Identifiers and Description

Gene Model Identifier

TTHERM_00531890

Standard Name

ZFR3 (Zinc Finger-Related 3)

Aliases

PreTt19849 | 68.m00138 | 3830.m00503 | COI9

Description

Zinc finger protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00097 ) zinc finger, C3HC4 type (RING

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00531890

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11798.17.000463540624081e-176hypothetical protein (862 aa)

General Information

Paragraph NoGene NameParagraph Text
136ZFR3Zfr3 interacts (CoIP) with Semi1 and colocalizes with Semi1 at the periphery of the selected haploid micronucleus in sexual reproduction.

Associated Literature

  1. Ref:31884169: Akematsu T, Sánchez-Fernández R, Kosta F, Holzer E, Loidl J (2019) The Transmembrane Protein Semi1 Positions Gamete Nuclei for Reciprocal Fertilization in Tetrahymena. iScience 23(1):100749
  2. Ref:25588944: Woehrer SL, Aronica L, Suhren JH, Busch CJ, Noto T, Mochizuki K (2015) A Tetrahymena Hsp90 co-chaperone promotes siRNA loading by ATP-dependent and ATP-independent mechanisms. The EMBO journal 34(4):559-77
  3. Ref:23251712: Xu J, Tian H, Wang W, Liang A (2012) The zinc finger protein Zfr1p is localized specifically to conjugation junction and required for sexual development in Tetrahymena thermophila. PloS one 7(12):e52799

Sequences

>TTHERM_00531890(coding)
ATGCAACACTTTGAAGAGACATAATCTTCAGAAAAACTGAGCCCAAATACAAGTAACTTG
TAGCCTCGTCAAGAGAAGCTATTGTGTTTTTGTGGAAGAGTTATCATAGAAAAACCTGTT
ACTTTACCTTGTGGTCATTAATACCACTTTAAATGTGCTAGAGATTATGTTTTTAATGTC
TAAACATAAATATAGAGTATTGAAGATATGATCTGCCCCTTTTGCTAAAGTAATAACAAT
AATTCCTAATGTGATAATTTTTAAACTAGTCACTACGTACTATAAGAGGAATTAGATGAA
GAGAATGAAAACTTTATTAATTTGAAATTTAAAAAGATAAATACTTAGCATAACAATAAC
TAAACTCCACTAAGCAATTAAACAAATACAAGCTTGAATTAGAATTCTTAAAATACCTCT
AATGATTAAAGTTTCAAATACTAAACTCCCAACATGAATAAATATAGCAAAAGGTCTAGA
TATTCTAATAATGATGACTCTAACAGCACAAATAAACAAAACAACTTAAATACATTTTTA
ATTAGTCCAGCCTAGGCATCATTCAAAAGTACTTAAGAGCGTGTGCCCTTTACAGATATA
ACTGCATAAATTAACAAAAAATCTCCTTAAACTTAATATAATTCAATAAAGAATAAAATT
TGTTTTGAAAATGTGAATTAGGATACAAGTAAAGAAATGTAGCCAAGAGAAATAATTCAA
AACAATTAATTTAGCTTTTATGAAAGCAAAATTTAAGAGTAAAAAGCTTAAAATATTAAC
CAACCTTTCGCTATTACAAATTCAGAATCCCAAAAGAATATTTATCAAAAAAATAGATAT
GGAAATTACATCTAAGTTTTGGGAGAAAGGATTATTAAGAAAAGTTTAGAAATAAAGAAT
AATTAATATTCTTCAATATCTGCTTCTTCTTCGTCATCCTCATCATTTTCTTCTTAATTA
TAAGGAAATCGAAATTCAATCTAAAAAATAAATCTCAGCTGTTCAGATATTATGTAAAAT
GTGTCTTTATCAGATTCAAGTTTAATTTCAAATAGCTTTTATTAGCAATACCCTTCTATC
TTTCCAAATAATGCTACTTCAAATATGTTTACCAGAATGAAATAAATTTTGCATTCATCA
TAAGTAATGAATTACTCATTTAATAATTCTATGGCTTCTATAGGTAGTGATAAAGAAAAT
GTTAGGAACATAACAACGAGAAGAGCAAGAAATAACGTTTTGTAAGCTTCATTTTATGAA
GGAGTTTCTTATATGTGCCCTAACAGCTTATACACTAAATTTAATAAAAAAGAGCAAGAA
AAGACTCTTTAAAATGAAATTTTTAAACCCGAAAAATAACTCTCAGATATTGAAGAAAGA
GATAAAGAATGTTTAGCATACCCATTTTGTATTGAGCTATCTAATTTATTTAATTCGAAT
GAGAATAATAATTTCAAGAATACCCAAGATTTTCTTATTCTGTTTGTACATGACAAATTA
ACAAGTGAGTAAAGATACCTAGCTATGAAAAGTCTTTACACATGTCTTGATACCTATGAT
ACTTTATCACTCTCTTGGATAAATTCCACTACAAATAAAGTATTTAAGTCTTCATCTGAT
TACTTTTTTGGAAGAGAAATGGATGAGTTAGTATCAAGCGAATTTATGAGGCTTTAAGCT
AACAAACAGTCTGAAATTATTTTAGAAGCTGACTAGAAACCAGAACTTACTCGCTAAAAA
GAGAATTATGTTTTAGATAGCGATGAAAAATCTGAAATCAAGAAGAAAAATCTAAGCCTA
TTTGTGCAAGAATAATTCAAACTGTTAAAGATCAAGAGAATGATTTAACATTTTGTATTA
ATATAAGCAGAGGATGTTGAGTTAAATTTTTTGAAAGAGCTAGATGGCATAAAAAATGTT
ATGACAAGTGTTATCAAAATCCCATCAAACATTTTAAATCTCTCAAATAGTTTGGAATTC
AGTGAAAGTTGTAAAAATCTCTTTAACAATCAAATTGATGGAACAAGGCGAACAAATATT
AAGAATTTAAATATAGCAATTGAGATTAATCCTTATTTAAATAATCTACTAGATCTATCC
CTTGTTAATAAAGAAGAGTTTTCAGCTAAAGTAAAAAAAACTACTCTAAGGAATGTAAAG
TCCTCTTCAAAAAGCAGTGAAAATCTAGTAACTGATGAAGAGCTAGAAAATTAAATGGAG
AAAGATAAACATAACGAAGTAGATTAATAATTGAGAGAAAACTCCAACTTTCCTGAATTA
AGCACAATATTTGAGGTTGATATTGACTATTTAAAAAAAGATAGAGAATTATTACTTTTT
GAAATTACATTTAGCAAGGACATAAACCCAAGTTATCAGAGCGCTCAGCTTTTTAATTGT
TCCATTTAATACGATTTTATTTATGTTGAATTACCAAATAACCAAATTGAATATTCGGTA
AACTCGCAAACAGGTGAGTTTGAATTATCTGATTCTTAAAATTTTATGAATTTTCCTCCT
ATGTTTTAAGACATTTCACAAAACTTAAAAAATCTATATCTTCTTTTTGAGTGGCATAAA
GACACAAATCATCTGCGTTATAATAGGAGAGTAATGTATTCATTTTGGGAGGAGGAAGTA
AAACAATCTAATTTATAACAAGTAATCTACGATAAATATAAACAGATTTTTGACTCAATT
GCTCAAAAAAAATAGAACTAAGATTTTGAAGAATATAAAATGTTCACAGAATATTATCAA
AAGCTATTGAAACTAAATCAAAATTGA


>TTHERM_00531890(protein)
MQHFEETQSSEKLSPNTSNLQPRQEKLLCFCGRVIIEKPVTLPCGHQYHFKCARDYVFNV
QTQIQSIEDMICPFCQSNNNNSQCDNFQTSHYVLQEELDEENENFINLKFKKINTQHNNN
QTPLSNQTNTSLNQNSQNTSNDQSFKYQTPNMNKYSKRSRYSNNDDSNSTNKQNNLNTFL
ISPAQASFKSTQERVPFTDITAQINKKSPQTQYNSIKNKICFENVNQDTSKEMQPREIIQ
NNQFSFYESKIQEQKAQNINQPFAITNSESQKNIYQKNRYGNYIQVLGERIIKKSLEIKN
NQYSSISASSSSSSSFSSQLQGNRNSIQKINLSCSDIMQNVSLSDSSLISNSFYQQYPSI
FPNNATSNMFTRMKQILHSSQVMNYSFNNSMASIGSDKENVRNITTRRARNNVLQASFYE
GVSYMCPNSLYTKFNKKEQEKTLQNEIFKPEKQLSDIEERDKECLAYPFCIELSNLFNSN
ENNNFKNTQDFLILFVHDKLTSEQRYLAMKSLYTCLDTYDTLSLSWINSTTNKVFKSSSD
YFFGREMDELVSSEFMRLQANKQSEIILEADQKPELTRQKENYVLDSDEKSEIKKKNLSL
FVQEQFKLLKIKRMIQHFVLIQAEDVELNFLKELDGIKNVMTSVIKIPSNILNLSNSLEF
SESCKNLFNNQIDGTRRTNIKNLNIAIEINPYLNNLLDLSLVNKEEFSAKVKKTTLRNVK
SSSKSSENLVTDEELENQMEKDKHNEVDQQLRENSNFPELSTIFEVDIDYLKKDRELLLF
EITFSKDINPSYQSAQLFNCSIQYDFIYVELPNNQIEYSVNSQTGEFELSDSQNFMNFPP
MFQDISQNLKNLYLLFEWHKDTNHLRYNRRVMYSFWEEEVKQSNLQQVIYDKYKQIFDSI
AQKKQNQDFEEYKMFTEYYQKLLKLNQN


>TTHERM_00531890(gene)
ATGCAACACTTTGAAGAGACATAATCTTCAGAAAAACTGAGCCCAAATACAAGTAACTTG
TAGCCTCGTCAAGAGAAGCTATTGTGTTTTTGTGGAAGAGTTATCATAGAAAAACCTGTT
ACTTTACCTTGTGGTCATTAATACCACTTTAAATGTGCTAGAGATTATGTTTTTAATGTC
TAAACATAAATATAGAGTATTGAAGATATGATCTGCCCCTTTTGCTAAAGTAATAACAAT
AATTCCTAATGTGATAATTTTTAAACTAGTCACTACGTACTATAAGAGGAATTAGATGAA
GAGAATGAAAACTTTATTAATTTGAAATTTAAAAAGATAAATACTTAGCATAACAATAAC
TAAACTCCACTAAGCAATTAAACAAATACAAGCTTGAATTAGAATTCTTAAAATACCTCT
AATGATTAAAGTTTCAAATACTAAACTCCCAACATGAATAAATATAGCAAAAGGTCTAGA
TATTCTAATAATGATGACTCTAACAGCACAAATAAACAAAACAACTTAAATACATTTTTA
ATTAGTCCAGCCTAGGCATCATTCAAAAGTACTTAAGAGCGTGTGCCCTTTACAGATATA
ACTGCATAAATTAACAAAAAATCTCCTTAAACTTAATATAATTCAATAAAGAATAAAATT
TGTTTTGGTAATTTTTAAAAATTTTTATTGATTTTTTATTTTTATTTTTTCAAAAATTAA
CAAAAGAAAATGTGAATTAGGATACAAGTAAAGAAATGTAGCCAAGAGAAATAATTCAAA
ACAATTAATTTAGCTTTTATGAAAGCAAAATTTAAGAGTAAAAAGCTTAAAATATTAACC
AACCTTTCGCTATTACAAATTCAGAATCCCAAAAGAATATTTATCAAAAAAATAGATATG
GAAATTACATCTAAGTTTTGGGAGAAAGGATTATTAAGAAAAGTTTAGAAATAAAGAATA
ATTAATATTCTTCAATATCTGCTTCTTCTTCGTCATCCTCATCATTTTCTTCTTAATTAT
AAGGAAATCGAAATTCAATCTAAAAAATAAATCTCAGCTGTTCAGATATTATGTAAAATG
TGTCTTTATCAGATTCAAGTTTAATTTCAAATAGCTTTTATTAGCAATACCCTTCTATCT
TTCCAAATAATGCTACTTCAAATATGTTTACCAGAATGAAATAAATTTTGCATTCATCAT
AAGTAATGAATTACTCATTTAATAATTCTATGGCTTCTATAGGTAGTGATAAAGAAAATG
TTAGGAACATAACAACGAGAAGAGCAAGAAATAACGTTTTGTAAGCTTCATTTTATGAAG
GAGTTTCTTATATGTGCCCTAACAGCTTATACACTAAATTTAATAAAAAAGAGCAAGAAA
AGACTCTTTAAAATGAAATTTTTAAACCCGAAAAATAACTCTCAGATATTGAAGAAAGAG
ATAAAGAATGTTTAGCATACCCATTTTGTATTGAGCTATCTAATTTATTTAATTCGAATG
AGAATAATAATTTCAAGAATACCCAAGATTTTCTTATTCTGTTTGTACATGACAAATTAA
CAAGTGAGTAAAGATACCTAGCTATGAAAAGTCTTTACACATGTCTTGATACCTATGATA
CTTTATCACTCTCTTGGATAAATTCCACTACAAATAAAGTATTTAAGTCTTCATCTGATT
ACTTTTTTGGAAGAGAAATGGATGAGTTAGTATCAAGCGAATTTATGAGGCTTTAAGCTA
ACAAACAGTCTGAAATTATTTTAGAAGCTGACTAGAAACCAGAACTTACTCGCTAAAAAG
AGAATTATGTTTTAGATAGCGATGAAAAATCTGAAATCAAGAAGAAAAATCTAAGCCTAT
TTGTGCAAGAATAATTCAAACTGTTAAAGATCAAGAGAATGATTTAACATTTTGTATTAA
TATAAGCAGAGGATGTTGAGTTAAATTTTTTGAAAGAGCTAGATGGCATAAAAAATGTTA
TGACAAGTGTTATCAAAATCCCATCAAACATTTTAAATCTCTCAAATAGTTTGGAATTCA
GTGAAAGTTGTAAAAATCTCTTTAACAATCAAATTGATGGAACAAGGCGAACAAATATTA
AGAATTTAAATATAGCAATTGAGATTAATCCTTATTTAAATAATCTACTAGATCTATCCC
TTGTTAATAAAGAAGAGTTTTCAGCTAAAGTAAAAAAAACTACTCTAAGGAATGTAAAGT
CCTCTTCAAAAAGCAGTGAAAATCTAGTAACTGATGAAGAGCTAGAAAATTAAATGGAGA
AAGATAAACATAACGAAGTAGATTAATAATTGAGAGAAAACTCCAACTTTCCTGAATTAA
GCACAATATTTGAGGTTGATATTGACTATTTAAAAAAAGATAGAGAATTATTACTTTTTG
AAATTACATTTAGCAAGGACATAAACCCAAGTTATCAGAGCGCTCAGCTTTTTAATTGTT
CCATTTAATACGATTTTATTTATGTTGAATTACCAAATAACCAAATTGAATATTCGGTAA
ACTCGCAAACAGGTGAGTTTGAATTATCTGATTCTTAAAATTTTATGAATTTTCCTCCTA
TGTTTTAAGACATTTCACAAAACTTAAAAAATCTATATCTTCTTTTTGAGTGGCATAAAG
ACACAAATCATCTGCGTTATAATAGGAGAGTAATGTATTCATTTTGGGAGGAGGAAGTAA
AACAATCTAATTTATAACAAGTAATCTACGATAAATATAAACAGATTTTTGACTCAATTG
CTCAAAAAAAATAGAACTAAGATTTTGAAGAATATAAAATGTTCACAGAATATTATCAAA
AGCTATTGAAACTAAATCAAAATTGA