Identifiers and Description

Gene Model Identifier

TTHERM_00531860

Standard Name

None

Aliases

PreTt19846 | 68.m00135 | 3830.m00500

Description

chromosome condensation regulator RCC1 repeat protein; regulator of chromosome condensation protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00415 ) Regulator of chromosome condensation (RCC1)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.5%

TetraMine Data

TTHERM_00531860

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19529.19.997093137033517e-262regulator-chromosome condensat
ion protein (407 aa)
OxytrichaContig1238.1.g1284.997860539111522e-53Regulator of chromosome conden
sation (RCC1) repeat
Stentor CoeruleusSteCoe_281631.2995814250075031e-24
DictyBaseDDB_G02781251.9999391735788327e-19DDB_G0278125 on chromosome: 3
position 327348 to 329843
WormBaseWBGene000171950.00000000007999955850159168locus:glo-4 X-linked retinit
is pigmentosa GTPase regulator
homolog status:Partially_co
nfirmed UniProt:Q5DX34 pro
tein_id:CCD68933.2
SGDYGL097W0.000006997203421143941SRM1 Nucleotide exchange facto
r for Gsp1p, localizes to the
nucleus, required for nucleocy
toplasmic trafficking of macro
molecules; suppressor of the p
heromone response pathway; pot
entially phosphorylated by Cdc
28p

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00531860(coding)
ATGTTCATTAGAAAGTATTTAAAAAACTTAGCTTTTGGCAGATATAATTTTTCTACCTAA
GCATAAAAGTAAGGTGGTAATCTTTACTTATGGTAAGGCAGCACATTTACTTCAACATCA
GATTTAAAGCCTGTCTTAGTTAAGGTTTGTGATGAAACCGGTAAATAGCTAAACAACAAG
GTTGAAAAAGTAGTTTTAGGTTAAAATGTTTCAGCTTTGATAACTACTGATGGTCATCTT
TATACATTTGGTGAAGGAAAGTTTGGTGCATTGGGTCACAATGATGGCAAAGATTACAAG
GAACCTAAGCATCTTGAATTCTTTGCTAAAAAGAATCTTCGTGTTGTTGACGTTACTTGT
GGTAATAGTTGTATGATGGCACTTACTCACGATGGAGATGTATGGACTTGGGGATGGGGT
GGAAAAGGCCGTAATATAATCATGTAGTAATTCTTTTCTTTTGCTGGTGCTTTAGGTCAT
GGCGATTAAAAACATCATTATTCTCCTCAACCTGTTCAAGCTTTACGTAAATTACCACAA
GTAAAATCCATTTCAGGAGGTCTCTATTTCTCTTTAGCTATGAATGTTTAAAACGAACTT
TATTATTGGGGCAGAGGTTCCCACGGTGCTTTTGGTGATGGCTACTCTAAAGATTTATTG
CTTCCCCGTAGACATAATTACTTTGATGTACTTTAAAAAACTGAAAAAACTATTATTAAA
TCATTAAAAAGTTGTAATTACTACACTGTTGCTCATCTTAGTGATGGCAAACTTGTCGGT
TGGGGATCAAACGACTATGGTTAAATGGGTATCAATAATGAAATTGGAGTTGAAATGCAT
GAAACTTCACCCTATCCATCTCTAGTGCACTCAGAAACATTTAAATCACCAATAGAAGAT
TTCTAAATAGCAGAAGATGTTGTAGTTATCAAGCTATAAAATGGTGAAATTCATTACAGT
GGCATGAAACTTGCTTATCTCCCTAAGAAATTCGAATTACCAACAGAAGCTGGTAAGATA
AAGACTTTTGGTGCTGCATTCCGTTCATTTGCCATAGTTGATGAAAATAATAATATATTT
ATGAAGAATAAATTCTTGAAAACAGATAACGAAAATATTAAAACTGGTGTCTATTCTGCA
GATAATACAGTATTCGATAGAGGAAATATTCTCTCTATTGGTGGTACTTATCGTACTCAC
TATGCAGTTGTATAACACTGA


>TTHERM_00531860(protein)
MFIRKYLKNLAFGRYNFSTQAQKQGGNLYLWQGSTFTSTSDLKPVLVKVCDETGKQLNNK
VEKVVLGQNVSALITTDGHLYTFGEGKFGALGHNDGKDYKEPKHLEFFAKKNLRVVDVTC
GNSCMMALTHDGDVWTWGWGGKGRNIIMQQFFSFAGALGHGDQKHHYSPQPVQALRKLPQ
VKSISGGLYFSLAMNVQNELYYWGRGSHGAFGDGYSKDLLLPRRHNYFDVLQKTEKTIIK
SLKSCNYYTVAHLSDGKLVGWGSNDYGQMGINNEIGVEMHETSPYPSLVHSETFKSPIED
FQIAEDVVVIKLQNGEIHYSGMKLAYLPKKFELPTEAGKIKTFGAAFRSFAIVDENNNIF
MKNKFLKTDNENIKTGVYSADNTVFDRGNILSIGGTYRTHYAVVQH


>TTHERM_00531860(gene)
ATGTTCATTAGAAAGTATTTAAAAAACTTAGCTTTTGGCAGATATAATTTTTCTACCTAA
GCATAAAAGTAAGGTGGTAATCTTTACTTATGGTAAGGCAGCACATTTACTTCAACATCA
GATTTAAAGCCTGTCTTAGTTAAGGTTTGTGATGAAACCGGTAAATAGCTAAACAACAAG
GTTGAAAAAGTAGTTTTAGGTTAAAATGTTTCAGCTTTGATAACTACTGATGGTCATCTT
TATACATTTGGTGAAGGAAAGTTTGGTGCATTGGGTCACAATGATGGCAAAGATTACAAG
GAACCTAAGCATCTTGAATTCTTTGCTAAAAAGAATCTTCGTGTTGTTGACGTTACTTGT
GGTAATAGTTGTATGATGGCACTTACTCACGATGGAGATGTATGGACTTGGGGATGGGGT
GGAAAAGGCCGTAATATAATCATGTAGTAATTCTTTTCTTTTGCTGGTGCTTTAGGTCAT
GGCGATTAAAAACATCATTATTCTCCTCAACCTGTTCAAGCTTTACGTAAATTACCACAA
GTAAAATCCATTTCAGGAGGTCTCTATTTCTCTTTAGCTATGAATGTTTAAAACGAACTT
TATTATTGGGGCAGAGGTTCCCACGGTGCTTTTGGTGATGGCTACTCTAAAGATTTATTG
CTTCCCCGTAGACATAATTACTTTGATGTACTTTAAAAAACTGAAAAAACTATTATTAAA
TCATTAAAAAGTTGTAATTACTACACTGTTGCTCATCTTAGTGATGGCAAACTTGTCGGT
TGGGGATCAAACGACTATGGTTAAATGGGTATCAATAATGAAATTGGAGTTGAAATGCAT
GAAACTTCACCCTATCCATCTCTAGTGCACTCAGAAACATTTAAATCACCAATAGAAGAT
TTCTAAATAGCAGAAGATGTTGTAGTTATCAAGCTATAAAATGGTGAAATTCATTACAGT
GGCATGAAACTTGCTTATCTCCCTAAGAAATTCGAATTACCAACAGAAGCTGGTAAGATA
AAGACTTTTGGTGCTGCATTCCGTTCATTTGCCATAGTTGATGAAAATAATAATATATTT
ATGAAGAATAAATTCTTGAAAACAGATAACGAAAATATTAAAACTGGTGTCTATTCTGCA
GATAATACAGTATTCGATAGAGGAAATATTCTCTCTATTGGTGGTACTTATCGTACTCAC
TATGCAGTTGTATAACACTGA