Identifiers and Description

Gene Model Identifier

TTHERM_00530720

Standard Name

None

Aliases

PreTt04735 | 67.m00250 | 3684.m00120 | MicNup98B | Nup96

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF01846 ) FF domain
  • ( PF04096 ) Nucleoporin autopeptidase
  • ( TIGR00864 ) polycystin cation channel protein
  • ( TIGR00449 ) tRNA-guanine transglycosylases, various specificities

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11%

TetraMine Data

TTHERM_00530720

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13582.17.001655022813022e-178nucleoporin autopeptidase (192
1 aa)
SGDYMR047C0.000000000006001570085597868NUP116 Subunit of the Nup82 su
bcomplex of the nuclear pore c
omplex; localized to both side
s of the pore; contains a repe
titive GLFG motif that interac
ts with mRNA export factor Mex
67p and with karyopherin Kap95
p; homologous to Nup100p
OxytrichaContig19821.0.0.g580.000000100009565553302Nucleoporin autopeptidase
WormBaseWBGene000037960.00000019998969434520019locus:npp-10 Nuclear pore co
mplex protein Nup98-Nup96 st
atus:Confirmed UniProt:G5EEH
9 protein_id:CCD70955.1

General Information

Paragraph NoGene NameParagraph Text
89TTHERM_00530720The first 2769 bp and later 3243 bp of TTHERM_00530720 (6012 bp) were expressed for MicNup98B and Nup96, respectively.

Associated Literature

  1. Ref:25788697: Iwamoto M, Koujin T, Osakada H, Mori C, Kojidani T, Matsuda A, Asakawa H, Hiraoka Y, Haraguchi T (2015) Biased assembly of the nuclear pore complex is required for somatic and germline nuclear differentiation in Tetrahymena. Journal of cell science 128(9):1812-23
  2. Ref:19375312: Iwamoto M, Mori C, Kojidani T, Bunai F, Hori T, Fukagawa T, Hiraoka Y, Haraguchi T (2009) Two distinct repeat sequences of Nup98 nucleoporins characterize dual nuclei in the binucleated ciliate tetrahymena. Current biology : CB 19(10):843-7

Sequences

>TTHERM_00530720(coding)
ATGATAAACAATCTGTTTGCGAATAATAACACTAACTAGCCAAATATATTTCAGAATAAT
AATAACTAAAACAACAATAATAATAGCAGTAATATCTTTAATCGCAGCGGCTAGAACATA
TTCCAGTCATAGAATAATAACGGATAAGTAAATATCTTTAACGCCAATAATAATAATAAT
TAAGTAGGATACTAGAACTAGAGTTAAAACATCTTTTAGCAAAATAGTAACATGAATAAT
GCCAGCAGCAGCAACAACAACAATATTTTTGGAAATAACATAAGTAATAACAACAATTAT
GGTGGAGCTTAAAATAATAATATTTTTAACAACAATAACTAAAATATGTACTAAAACAGT
AATAACCCTAATGCTTTGATAGGTTCTTAAAGAGGTAAGTATGAATTAACAAAATCTCCT
CACACTGAAACTTAATAAAATAATCAAGCGGGAGTAATAATGAATACAAGTATTATTTTC
TGTAAAGGATTTGAAAAAATGAATCCTTTGTTGGTAAGGCTCGAAGATTATTACTTGATA
AGAACAGGCAAATTATCTGATGCTGAAAAATAAAAAATAACTAGCTCAATATAAATAAAC
TCCTTTAACTAAAATCTTATTACCAACCTTCCTTAAAACTTTTAACCTCCAAACACTTAA
GCATTAAATAAAGACATTCGCATGGTTTAAAGTTAATATGTAGGTAATGTGAATAATAAT
AATAATATTTTTAACAATAACAACAATAACGGTAATAATAACAATATATTTGCAAATAAT
AACAATGTAAACAACTCAGTTAATCGGAACATTTTTAATAACAACAACATTAGCACTAAC
AACAACATTAACAATAACAACAATGGCAATATATTTAATAATAATAATAATAACATGAAT
AATAATGGAGGAAATATCTTTTCTGGAAATAATAATTAGAATAATAATGTAAATAACATA
TTTAGCTTTAACAATAGTTAAAACAACAATATGAATAAATCTAATATCTTCAACAATGGG
AACAGCACTAATAACACTAGCAATATTTTCTAAAATAATAATACAAATATGGGAAACAAC
AGCATATTTTAAGGAAATAACAATAATAACAATAATAATATTTTTAGAAATGATAATTCT
ACAAATAATACTAATTTGAATATTTTTAGTAATAATAACAACAACATTAATAATAGTATA
TTTAGAAACAATAATAACAACAATACAAATATTTTTAACAATGGTAATAATAATGGTGGG
AACAATACTTCAAGTATCTTTAATAATAGTGGTAGCAATAATAGTGTTAATATTTTCAGA
AGTAATAACAATAATAATGGAGGTAGCATTTTCTCAAATAATAATAATAGCTCAGTCTAA
AACATATTCTAAAAAAATAACTCCTCAATATTTAATAACAACAATAATAACGGAGGTAGC
ATTTTTAATAACAATAACTCAATATTTGGGCCTAATGTTTAGGGAGGAAATATATTTTAA
AATAACAACAATAATAATTTTAACAATGGAAATATTTTTACAAATTATAACAATCCTTAA
ATGTACTAATCAAACCTTCCTGGACCTGCTAACGGATATTATTCTATTTAATCGGGTATG
TATTATGCTCCAACAATCTAAACTGGTGATTTAACTAGATAATAATATTTAGATCTGCTA
GAATAAGAAGCTGAAGATAAAAAGGTAGTTAAATAATCGTATTTTATGCCATCATTTTGT
CCTGAAGAATATGCTCCTGCTTTTAGGAAAAAGCCCATATTTAAGCCATTTTATGTAACA
GTTTAAGAAGAAAAAGGGATAAGAAAGTTAGCAAAGTCACTTCTTCCTCTTTAAGAAACT
ATAGCAAAAACTTAAAGAGGCCATTCTTCAGAGACTACTTCAAATGGAAAAAATGATTCA
TTTTAGCTCACATAATCTGCAATAAAGTAAAGGAAATAAATGGAAGAATTTAATTTCTAT
AAATAGCCCGCCTAAGAAACAAAGGGTAGAGAAATGTACGCTAGATAGCAACTATCCCAT
ACGAACCCAGTTAGCATTAAAGTTGAAGTACTTTGTAGCACTCTGGAAGGAGAAGAAGAG
GAAATTACTTTAGAGAACTAAATAGATACACTAAGTAAAATAAAATAAATAGGATTATAT
TGTAAAGACCATTTACTAAAAATGGGTAAAATGAAAGAAGACTCTCGTCCTTACTCATTT
TAAATTTATTATGATGGAAGTCTCATTAGAAACCAAGAATTACTAGCAAGTGATGTCTTT
CCTGTTAAGTTAGAAGCTACTTATTAGTGTGAAGTCATATTCTTGTACGATAGGTATCCT
TTTATGAATACTTCTGATTACATAATCAACCCACCTTTGGAAGAGCTTCAGACTTATTCA
TTAAAAGAGTTGAAAAATGTTCATAATTTTAGCGTAGAAGGTCATTATGGAAAGTTAGAG
TGGTAAGAACCAGTTGACTTAACAGACTTAGATATTGACAAGACCATTTACATTAGAGAT
TAGCAAATATAAGTTTATCCTGAAGTTGAATATGCATCAAAATACAAACCAAAAGTAGGA
GAAGGAATAAATAATAAATGTATGATCACATATAAGAATGCATCTTCAATACAAAGGAAA
ATTAAATCTGGAGAGCTCAATCTATAAACTGTAATTAAGTGCATAAAAAAGTAAAGTGAT
GAATAAAATGTCTAATTTGTTAAATTTGATCAAAAAAATCTAACTTGGACAATATTAGTT
GATCATTTTTCAGGATATTAATTTAATCTTGATGAGTAAGACGATGAAGAAAATAAGGAA
GGACAGGATTCTGCTGCTAATTTATAAAATGTATCAAGCAATTCAAATTCTAGATCAAAT
CCATCTAAGTAGTAATAATTAATCTAAGGTTAACAATAATTTAATTAAGACTCGTAAAGA
ACTGCCAATTAGTAATTACAATAATAATAATTATAGGCTGAAAATTAGTTTTAACAAAAG
ATAAATAGCTCTTACTAATAGCTTCCGATGAGATAACATATTTAAAATTCTAACTAATTT
AAGTAAATATATGGTTAAAATGAGCATTAGCCTTCTGAAACATAAAAATATATCAATTAA
ATGAGAGAGCAATAGAATGTTAGCAAGTCTTAGGAAAATTCATTTATTCAACAAGATTAT
CCAATTACTTCTCATTAACAATAAAACAGCAACTACTAAATGAATGAACATAATTAATAT
TAAAATTAACCTAGTTATATGAATCGCGGCTAATTATAGCAATAACAATATTATGGAACT
CATATTGATCCTTCTAATGATATTATAATTGAAGAAGTTGAAAACGGATCATATAATAAT
ACTTAAGCAGATATTGATACTTTGAAATCTTAAGCTTAAGAATTAATTGAGCCTGTTTAT
CAGTTGCCAAAGACTTCATATTAGTAGTTCTTACGCTAGCAAAATAATGAAGAATAATTT
GTAAATTTGTAAAACAAGTAGAAGCCCTTAAATAATTTTAAAGATTTTAAAACTAGAGTA
GACCAACGCAAAAATAAAATATTTTAAAAAGAATAGCAAGTCCCTAAATGTGGTGTTCTT
TACTAAAGTGTTAAAAAACATGAGATTGTAGCCAGAGGTATTTAGACTTTAAACCAATGT
CTTTACTAACACTCAGTAAAGGAGTACACATTTAAAGGGAAGAAATTTTACAATGACTTT
TCTTTTTGTCCCTCTTGGAACTAAAATAGTTATACAAGCTATTCTTCTAAGCTTAAAGCA
ATTAAAAAGCACACAATTCTTCCAAACAATATGGGAAGGATAAAAATTAAAGATAAATAG
AGAGATTAAATTGAGAAATATAACAACATAGTCATTAACGGATTTTTATAAAGTATTATT
GATAGTTAAGCAACTAATGTAATAGAAAATATAGATCAAATCACTAAATTATATACCAAA
GACTAAGGAATGTCTGATACCTAGATTTGGAGCACTCTTCCTGAAATAAAAATTCCTACA
GATAACCAATACACATTATTTTTAATTATCTATATAAAAAATTATCTTTTACCAGTTTTA
AGTGCATCAAAAAATAATCAAAACGATTTATACCAGTCTTTAAAAGAAGAACTAAGTATA
CTTATCATGGTCAATATACTTTTTGGTAATCCTTAAATAGATGTTATCTCGATTTTAAAG
AAGGTAAATAAAAATTCATTTAGTGAAAATCAATGGAAGGTACTCTTTGAAGGTCTAAGA
AATAACAAGATGAATTAAAATGAAAAAGTTGTACAAAATTTGAGAAAGAAATAACTAAAA
AAGTACTTTGAGTGGAAATATTCTGAAAATAAAGTCTAAATTAATGAGTAAAGAGCATTC
TTAGATATGAAGGAAATGAAAACTCAAGAAGAAGTTGAAGATGCTATAATTTAATGCCTC
AAGAATCATTAAATTTAAAATGCTATTTAATTAGCTGATAATTATAAATTACATACTATA
AGCCATCTTTTAACAACTTTTGAATAAGGATCTGTTGAAAATTAGATAAAATAGCTTAAT
CAAGATAAATACCAAAACTTTAATAGAATAATTAATTTTGTTAGCGGCAATTTAGAAGAA
TTGTACAAATAAAGCTAGAGAAATGAAATATCAAATTTAAATAAATTTGCTTGTGAAATT
TGGTATTAAAAAAATTAGAGATAGAGTTTAGCAGAAACTTTTGATTAATTTGTATAAAAA
GTAGATAAATAAATATATGATGTTGATTCAAGATAATAAATAATCTCATTAGAAATTCTT
CTATTGTCTCTTTATGCTTAGCATTAGTTAGGTGAAAATTATGTAAGTAAATAGCTTGTA
AATATCAATATATTTGCTTAAATAAATTCATAGTGTTATTCTTAAAACAGACTTGATAAA
CGTCTAAGTTGGTTTATTATTGAATTTATGAATAGCGTCTATTTTAGTAATGATAAAGCT
CTTTTGAAAGATAAACGTGCAAGACTTATGAGAGGTTTTCTTTAATAACTATAAATTTTG
AAGAAATGGAAATATGAATTAATAGTTTTGATAATAATGAAAGATATTATCAGAAAACCA
TAATTTATTTCTAGCATAAAGAATACATTCTTACGTAACTGTATTCCTTAAATAAGTTAA
GAAGATAAATCAGAAGTAGGCTAGCCAAATAATTTAAATAATAAATTCTTGATTTAATCC
AGCAACAGAGACAGTTCTTCTGATAATTCATTAGAAATCAACAAAAGTTTTCAAATTGAC
TCAGAAAATAGCAACAGTGTTGAACGTTTGCTATACTTAATATATACTTAGTATTTCCAT
CAATCCTTAGGATTGTATTATTATAATTCTCAAATTTATTAGTCTGCACTATATCACTTT
ATGAGAGATCCCAATTTAACATATTTAGATATTAGCAATAAAATATTAGCATACTATGAA
GGACCTCGTATATATTTATTTGGTGAATAGAATGAGCGCTAAGAGATTGAAAAGTACTTG
GAACAGATTGCAAAAAAAGCAAATTTAATTTTCAAATACAAGTATTAATCTGGGTTAATA
AAAGAAGTTTTTTCCCTTTTGCAAAGTAATAACTAAGACCAATATAAGCAAGAATATATA
AATGGCATTATAAATCTTAAAGATCTCCTATTAGAAACTCAAAATGTGTTAAATTTAGTT
ATTTATCCCCATCAATATCAAGTTATAGTAGATAATTAAGAATTTTAATCTAAGAATAGA
AGACTACAAAGTAAGACTGATGATTCAGTAACAACTTTAGACAATGGCGGAATGCTCTTC
TAAGAATTTATTTCTTTCATATTCTAATAACTTGCAGAAAAGGTACCAGATATTAGAAGA
TATTCTTAACATTATTAAACTTCTGGTGATATTCAACAACTCTTAGAAATAGTATCTGAG
CATAAAGCCCCTAAAAATGAATAAATAAAGCACCTCATCCTATCAACTTTAAAATAAAAT
TAATATATGTGA


>TTHERM_00530720(protein)
MINNLFANNNTNQPNIFQNNNNQNNNNNSSNIFNRSGQNIFQSQNNNGQVNIFNANNNNN
QVGYQNQSQNIFQQNSNMNNASSSNNNNIFGNNISNNNNYGGAQNNNIFNNNNQNMYQNS
NNPNALIGSQRGKYELTKSPHTETQQNNQAGVIMNTSIIFCKGFEKMNPLLVRLEDYYLI
RTGKLSDAEKQKITSSIQINSFNQNLITNLPQNFQPPNTQALNKDIRMVQSQYVGNVNNN
NNIFNNNNNNGNNNNIFANNNNVNNSVNRNIFNNNNISTNNNINNNNNGNIFNNNNNNMN
NNGGNIFSGNNNQNNNVNNIFSFNNSQNNNMNKSNIFNNGNSTNNTSNIFQNNNTNMGNN
SIFQGNNNNNNNNIFRNDNSTNNTNLNIFSNNNNNINNSIFRNNNNNNTNIFNNGNNNGG
NNTSSIFNNSGSNNSVNIFRSNNNNNGGSIFSNNNNSSVQNIFQKNNSSIFNNNNNNGGS
IFNNNNSIFGPNVQGGNIFQNNNNNNFNNGNIFTNYNNPQMYQSNLPGPANGYYSIQSGM
YYAPTIQTGDLTRQQYLDLLEQEAEDKKVVKQSYFMPSFCPEEYAPAFRKKPIFKPFYVT
VQEEKGIRKLAKSLLPLQETIAKTQRGHSSETTSNGKNDSFQLTQSAIKQRKQMEEFNFY
KQPAQETKGREMYARQQLSHTNPVSIKVEVLCSTLEGEEEEITLENQIDTLSKIKQIGLY
CKDHLLKMGKMKEDSRPYSFQIYYDGSLIRNQELLASDVFPVKLEATYQCEVIFLYDRYP
FMNTSDYIINPPLEELQTYSLKELKNVHNFSVEGHYGKLEWQEPVDLTDLDIDKTIYIRD
QQIQVYPEVEYASKYKPKVGEGINNKCMITYKNASSIQRKIKSGELNLQTVIKCIKKQSD
EQNVQFVKFDQKNLTWTILVDHFSGYQFNLDEQDDEENKEGQDSAANLQNVSSNSNSRSN
PSKQQQLIQGQQQFNQDSQRTANQQLQQQQLQAENQFQQKINSSYQQLPMRQHIQNSNQF
KQIYGQNEHQPSETQKYINQMREQQNVSKSQENSFIQQDYPITSHQQQNSNYQMNEHNQY
QNQPSYMNRGQLQQQQYYGTHIDPSNDIIIEEVENGSYNNTQADIDTLKSQAQELIEPVY
QLPKTSYQQFLRQQNNEEQFVNLQNKQKPLNNFKDFKTRVDQRKNKIFQKEQQVPKCGVL
YQSVKKHEIVARGIQTLNQCLYQHSVKEYTFKGKKFYNDFSFCPSWNQNSYTSYSSKLKA
IKKHTILPNNMGRIKIKDKQRDQIEKYNNIVINGFLQSIIDSQATNVIENIDQITKLYTK
DQGMSDTQIWSTLPEIKIPTDNQYTLFLIIYIKNYLLPVLSASKNNQNDLYQSLKEELSI
LIMVNILFGNPQIDVISILKKVNKNSFSENQWKVLFEGLRNNKMNQNEKVVQNLRKKQLK
KYFEWKYSENKVQINEQRAFLDMKEMKTQEEVEDAIIQCLKNHQIQNAIQLADNYKLHTI
SHLLTTFEQGSVENQIKQLNQDKYQNFNRIINFVSGNLEELYKQSQRNEISNLNKFACEI
WYQKNQRQSLAETFDQFVQKVDKQIYDVDSRQQIISLEILLLSLYAQHQLGENYVSKQLV
NINIFAQINSQCYSQNRLDKRLSWFIIEFMNSVYFSNDKALLKDKRARLMRGFLQQLQIL
KKWKYELIVLIIMKDIIRKPQFISSIKNTFLRNCIPQISQEDKSEVGQPNNLNNKFLIQS
SNRDSSSDNSLEINKSFQIDSENSNSVERLLYLIYTQYFHQSLGLYYYNSQIYQSALYHF
MRDPNLTYLDISNKILAYYEGPRIYLFGEQNERQEIEKYLEQIAKKANLIFKYKYQSGLI
KEVFSLLQSNNQDQYKQEYINGIINLKDLLLETQNVLNLVIYPHQYQVIVDNQEFQSKNR
RLQSKTDDSVTTLDNGGMLFQEFISFIFQQLAEKVPDIRRYSQHYQTSGDIQQLLEIVSE
HKAPKNEQIKHLILSTLKQNQYM


>TTHERM_00530720(gene)
ATGATAAACAATCTGTTTGCGAATAATAACACTAACTAGCCAAATATATTTCAGAATAAT
AATAACTAAAACAACAATAATAATAGCAGTAATATCTTTAATCGCAGCGGCTAGAACATA
TTCCAGTCATAGAATAATAACGGATAAGTAAATATCTTTAACGCCAATAATAATAATAAT
TAAGTAGGATACTAGAACTAGAGTTAAAACATCTTTTAGCAAAATAGTAACATGAATAAT
GCCAGCAGCAGCAACAACAACAATATTTTTGGAAATAACATAAGTAATAACAACAATTAT
GGTGGAGCTTAAAATAATAATATTTTTAACAACAATAACTAAAATATGTACTAAAACAGT
AATAACCCTAATGCTTTGATAGGTTCTTAAAGAGGTAAGTATGAATTAACAAAATCTCCT
CACACTGAAACTTAATAAAATAATCAAGCGGGAGTAATAATGAATACAAGTATTATTTTC
TGTAAAGGATTTGAAAAAATGAATCCTTTGTTGGTAAGGCTCGAAGATTATTACTTGATA
AGAACAGGCAAATTATCTGATGCTGAAAAATAAAAAATAACTAGCTCAATATAAATAAAC
TCCTTTAACTAAAATCTTATTACCAACCTTCCTTAAAACTTTTAACCTCCAAACACTTAA
GCATTAAATAAAGACATTCGCATGGTTTAAAGTTAATATGTAGGTAATGTGAATAATAAT
AATAATATTTTTAACAATAACAACAATAACGGTAATAATAACAATATATTTGCAAATAAT
AACAATGTAAACAACTCAGTTAATCGGAACATTTTTAATAACAACAACATTAGCACTAAC
AACAACATTAACAATAACAACAATGGCAATATATTTAATAATAATAATAATAACATGAAT
AATAATGGAGGAAATATCTTTTCTGGAAATAATAATTAGAATAATAATGTAAATAACATA
TTTAGCTTTAACAATAGTTAAAACAACAATATGAATAAATCTAATATCTTCAACAATGGG
AACAGCACTAATAACACTAGCAATATTTTCTAAAATAATAATACAAATATGGGAAACAAC
AGCATATTTTAAGGAAATAACAATAATAACAATAATAATATTTTTAGAAATGATAATTCT
ACAAATAATACTAATTTGAATATTTTTAGTAATAATAACAACAACATTAATAATAGTATA
TTTAGAAACAATAATAACAACAATACAAATATTTTTAACAATGGTAATAATAATGGTGGG
AACAATACTTCAAGTATCTTTAATAATAGTGGTAGCAATAATAGTGTTAATATTTTCAGA
AGTAATAACAATAATAATGGAGGTAGCATTTTCTCAAATAATAATAATAGCTCAGTCTAA
AACATATTCTAAAAAAATAACTCCTCAATATTTAATAACAACAATAATAACGGAGGTAGC
ATTTTTAATAACAATAACTCAATATTTGGGCCTAATGTTTAGGGAGGAAATATATTTTAA
AATAACAACAATAATAATTTTAACAATGGAAATATTTTTACAAATTATAACAATCCTTAA
ATGTACTAATCAAACCTTCCTGGACCTGCTAACGGATATTATTCTATTTAATCGGGTATG
TATTATGCTCCAACAATCTAAACTGGTGATTTAACTAGATAATAATATTTAGATCTGCTA
GAATAAGAAGCTGAAGATGTAAATTTTTTTACTTATAAATTAATCATAAATGTATTACTT
AATAAAGAAAAAGGTAGTTAAATAATCGTATTTTATGCCATCATTTTGTCCTGAAGAATA
TGCTCCTGCTTTTAGGAAAAAGCCCATATTTAAGCCATTTTATGTAACAGTTTAAGAAGA
AAAAGGGATAAGAAAGTTAGCAAAGTCACTTCTTCCTCTTTAAGAAACTATAGCAAAAAC
TTAAAGAGGCCATTCTTCAGAGACTACTTCAAATGGAAAAAATGATTCATTTTAGCTCAC
ATAATCTGCAATAAAGTAAAGGAAATAAATGGAAGAATTTAATTTCTATAAATAGGTAAG
CTTAATTTTTAAATTTATTTTTTAAAATAATTTAAATATATTTGAATTTAAAAAGCCCGC
CTAAGAAACAAAGGGTAGAGAAATGTACGCTAGATAGCAACTATCCCATACGAACCCAGT
TAGCATTAAAGTTGAAGTACTTTGTAGCACTCTGGAAGGAGAAGAAGAGGAAATTACTTT
AGAGAACTAAATAGATACACTAAGTAAAATAAAATAAATAGGATTATATTGTAAAGACCA
TTTACTAAAAATGGGTAAAATGAAAGAAGACTCTCGTCCTTACTCATTTTAAATTTATTA
TGATGGAAGTCTCATTAGAAACCAAGAATTACTAGCAAGTGATGTCTTTCCTGTTAAGTT
AGAAGCTACTTATTAGGTAAAAAATATATCTTGGCTAATTTATCAAAAAAAATTTTCAAA
ATCTTTGATAAGTAGAATTCAGTTTAAATTTTTTTTTTTTGAAGGTGTTAAATTTTACTT
AACAAAAGTAGACTCTAACTAACACTAAGAAAAAATAAAATAATGATAGATGCTGAAACT
TTATTTTTAGTTTAACTAGAGATAGTTAATAATAATAAAGATAGCAAGTATCTTTTTAAT
TTATTTTTGAAAATTAAAGATAAATCTTAGATAGATAGAGATTATGAAAAAGTATATTTT
ATTAAAATAAATAAAAAACAAAGAAATAATATCTATCTATTCACATCAAATAGCATACAA
ATTTATTATTGATGATTTGCATAAACCCTTAAAATAATTTTTCAAATCAATTATCTTAAA
ATAAATAGTGTGAAGTCATATTCTTGTACGATAGGTATCCTTTTATGAATACTTCTGATT
ACATAATCAACCCACCTTTGGAAGAGCTTCAGACTTATTCATTAAAAGAGTTGAAAAATG
TTCATAATTTTAGCGTAGAAGGTCATTATGGAAAGTTAGAGTGGTAAGAACCAGTTGACT
TAACAGACTTAGATATTGACAAGGTATACATACATACTTGCAGAATTTAATTGTTTCTTA
TAAATAATAAAAATTTGTTTAATTTATCAAATTTAAGTAAATCAATCAACTTTAAATAAA
ATTAGACCATTTACATTAGAGATTAGCAAATATAAGTTTATCCTGAAGTTGAATATGCAT
CAAAATACAAACCAAAAGTAGGAGAAGGAATAAATAATAAATGTATGATCACATATAAGA
ATGCATCTTCAATACAAAGGAAAATTAAATCTGGAGAGCTCAATCTATAAACTGTAATTA
AGTGCATAAAAAAGTAAAGTGATGAATAAAATGTCTAATTTGTTAAATTTGATCAAAAAA
ATCTAACTTGGACAATATTAGTTGATCATTTTTCAGGATATTAATTTAATCTTGATGAGT
AAGACGATGAAGAAAATAAGGAAGGACAGGATTCTGCTGCTAATTTATAAAATGTATCAA
GCAATTCAAATTCTAGATCAAATCCATCTAAGTAGTAATAATTAATCTAAGGTTAACAAT
AATTTAATTAAGACTCGTAAAGAACTGCCAATTAGTAATTACAATAATAATAATTATAGG
CTGAAAATTAGTTTTAACAAAAGATAAATAGCTCTTACTAATAGCTTCCGATGAGATAAC
ATATTTAAAATTCTAACTAATTTAAGTAAATATATGGTTAAAATGAGCATTAGCCTTCTG
AAACATAAAAATATATCAATTAAATGAGAGAGCAATAGAATGTTAGCAAGTCTTAGGAAA
ATTCATTTATTCAACAAGATTATCCAATTACTTCTCATTAACAATAAAACAGCAACTACT
AAATGAATGAACATAATTAATATTAAAATTAACCTAGTTATATGAATCGCGGCTAATTAT
AGCAATAACAATATTATGGAACTCATATTGATCCTTCTAATGATATTATAATTGAAGAAG
TTGAAAACGGATCATATAATAATACTTAAGCAGATATTGATACTTTGAAATCTTAAGCTT
AAGAATTAATTGAGCCTGTTTATCAGTTGCCAAAGACTTCATATTAGTAGTTCTTACGCT
AGCAAAATAATGAAGAATAATTTGTAAATTTGTAAAACAAGTAGAAGCCCTTAAATAATT
TTAAAGATTTTAAAACTAGAGTAGACCAACGCAAAAATAAAATATTTTAAAAAGAATAGC
AAGTCCCTAAATGTGGTGTTCTTTACTAAAGTGTTAAAAAACATGAGATTGTAGCCAGAG
GTATTTAGACTTTAAACCAATGTCTTTACTAACACTCAGTAAAGGAGTACACATTTAAAG
GGAAGAAATTTTACAATGACTTTTCTTTTTGTCCCTCTTGGAACTAAAATAGTTATACAA
GCTATTCTTCTAAGCTTAAAGCAATTAAAAAGCACACAATTCTTCCAAACAATATGGGTA
ATTAAAAAAATCATTTATTTTTAAATTTTACATTTATAATAAATAATATCAATTTCATTT
TTTATTTTTTAAATAAAAGGAAGGATAAAAATTAAAGATAAATAGAGAGATTAAATTGAG
AAATATAACAACATAGTCATTAACGGATTTTTATAAAGTATTATTGATAGTTAAGCAACT
AATGTAATAGAAAATATAGATCAAATCACTAAATTATATACCAAAGACTAAGGAATGTCT
GATACCTAGATTTGGAGCACTCTTCCTGAAATAAAAATTCCTACAGATAACCAATACACA
TTATTTTTAATTATCTATATAAAAAATTATCTTTTACCAGTTTTAAGTGCATCAAAAAAT
AATCAAAACGATTTATACCAGTCTTTAAAAGAAGAACTAAGTATACTTATCATGGTCAAT
ATACTTTTTGGTAATCCTTAAATAGATGTTATCTCGATTTTAAAGAAGGTAATTAATTAA
TTAATTCATTTTTTTATACTCTTGTGAAAAATTTTTTAAAAATAAGTTTTTGTTAATTTT
ACATTTTATAAACACAAAAAAGGTAAATAAAAATTCATTTAGTGAAAATCAATGGAAGGT
ACTCTTTGAAGGTCTAAGAAATAACAAGATGAATTAAAATGAAAAAGTTGTACAAAATTT
GAGAAAGAAATAACTAAAAAAGTACTTTGAGTGGAAATATTCTGAAAATAAAGTCTAAAT
TAATGAGTAAAGAGCATTCTTAGATATGAAGGAAATGAAAACTCAAGAAGAAGTTGAAGA
TGCTATAATTTAATGCCTCAAGAATCATTAAATTTAAAATGCTATTTAATTAGCTGATAA
TTATAAATTACATACTATAAGCCATCTTTTAACAACTTTTGAATAAGGATCTGTTGAAAA
TTAGATAAAATAGCTTAATCAAGATAAATACCAAAACTTTAATAGAATAATTAATTTTGT
TAGCGGCAATTTAGAAGAATTGTACAAATAAAGCTAGAGAAATGAAATATCAAATTTAAA
TAAATTTGCTTGTGAAATTTGGTATTAAAAAAATTAGAGATAGAGTTTAGCAGAAACTTT
TGATTAATTTGTATAAAAAGTAGATAAATAAATATATGATGTTGATTCAAGATAATAAAT
AATCTCATTAGAAATTCTTCTATTGTCTCTTTATGCTTAGCATTAGTTAGGTGAAAATTA
TGTAAGTAAATAGCTTGTAAATATCAATATATTTGCTTAAATAAATTCATAGTGTTATTC
TTAAAACAGACTTGATAAACGTCTAAGTTGGTTTATTATTGAATTTATGAATAGCGTCTA
TTTTAGTAATGATAAAGCTCTTTTGAAAGATAAACGTGCAAGACTTATGAGAGGTTTTCT
TTAATAACTATAAATTTTGAAGAAATGGAAATATGAATTAATAGTTTTGATAATAATGAA
AGATATTATCAGAAAACCATAATTTATTTCTAGCATAAAGAATACATTCTTACGTAACTG
TATTCCTTAAATAAGTTAAGAAGATAAATCAGAAGTAGGCTAGCCAAATAATTTAAATAA
TAAATTCTTGATTTAATCCAGCAACAGAGACAGTTCTTCTGATAATTCATTAGAAATCAA
CAAAAGTTTTCAAATTGACTCAGAAAATAGCAACAGTGTTGAACGTTTGCTATACTTAAT
ATATACTTAGTATTTCCATCAATCCTTAGGATTGTATTATTATAATTCTCAAATTTATTA
GTCTGCACTATATCACTTTATGAGAGATCCCAATTTAACATATTTAGATATTAGCAATAA
AATATTAGCATACTATGAAGGACCTCGTATATATTTATTTGGTGAATAGAATGAGCGCTA
AGAGATTGAAAAGTACTTGGAACAGATTGCAAAAAAAGCAAATTTAATTTTCAAATACAA
GTATTAATCTGGGTTAATAAAAGAAGTTTTTTCCCTTTTGCAAAGTAATAACTAAGACCA
ATATAAGCAAGAATATATAAATGGCATTATAAATCTTAAAGATCTCCTATTAGAAACTCA
AAATGTGTTAAATTTAGTTATTTATCCCCATCAATATCAAGTTATAGTAGATAATTAAGA
ATTTTAATCTAAGAATAGAAGACTACAAAGTAAGACTGATGATTCAGTAACAACTTTAGA
CAATGGCGGAATGCTCTTCTAAGAATTTATTTCTTTCATATTCTAATAACTTGCAGAAAA
GGTACCAGATATTAGAAGATATTCTTAACATTATTAAACTTCTGGTGATATTCAACAACT
CTTAGAAATAGTATCTGAGCATAAAGCCCCTAAAAATGAATAAATAAAGCACCTCATCCT
ATCAACTTTAAAATAAAATTAATATATGTGA