Identifiers and Description

Gene Model Identifier

TTHERM_00530659

Standard Name

BIME2 (BIvalents in MEiosis)

Aliases

3684.m00838

Description

Required for wild-type frequency of meiotic bivalent formation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.4%

TetraMine Data

TTHERM_00530659

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_41155.19.997639769646959e-151hypothetical protein (415 aa)

General Information

Paragraph NoGene NameParagraph Text
116BIME2Bime2 protein is distantly related to budding yeast Rdh54/Tid1 and the vertebrate Rad54B helicases. In the bime2 deletion mutant, meiotic crossovers are reduced to an estimated 18% of the wild-type number.

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00530659(protein)
MAIQPKAKFYLIGNNQFLLQSQYPIIQQKLVSLLQNLGINIKNEESFTQKILLSNEDRKK
ILKNEEIQKLIKIKDIPKFLKQIISLPKYQVDQTQIQKKIKQLSDVKPSKYFVQFFIDYI
EKQGKILFLDDEIFPKVETISFLIKILCLNYEKPCLIVTDSYKVDNWKIKVQKWIPNQKI
SKIQNQNDTVQSCPLVIIVNYEHFQNNYECLSVINFEFLILDIHVDQIKTNNYDSLCKIR
SNTKSVIIIENYERLNTIEDYWLYLAILHSTIFKFERFSKLQKRYAILDQNSVSYQEFSY
ILSEFFQTNKSRENHKIESQSLFQKFSIELNLKQKKQVQLIQRQFNGWEIQEFANIGYHT
NEDINTYFQYLTNLKEQHKNTLLKYLSLLKRKTLVIADGDQVLCKLFKKYKNVQFISSES
DLSIVSLKEYGQILILEIDQNYEVKKAFIQRLKQDEIIKTRMIFLEIADTLDSTLIDYFI
S


>TTHERM_00530659(coding)
ATGGCAATTCAACCAAAGGCAAAGTTTTATTTAATAGGAAATAACTAATTTTTGTTGTAA
AGCCAATATCCAATAATACAATAAAAACTAGTTAGCTTATTGTAAAATTTAGGAATCAAC
ATAAAAAATGAAGAGAGTTTTACATAAAAAATACTGTTAAGCAATGAAGATAGAAAAAAA
ATATTGAAAAATGAAGAAATTTAAAAGCTGATCAAAATCAAAGACATCCCAAAGTTTTTA
AAATAAATTATATCTCTACCCAAGTATTAAGTAGACTAGACTCAAATTCAAAAAAAAATT
AAATAACTAAGTGATGTTAAACCTTCTAAGTATTTTGTTTAGTTTTTTATTGATTACATA
GAAAAGCAAGGTAAGATTCTTTTCCTAGATGATGAAATATTTCCAAAGGTAGAAACTATA
TCATTTCTAATTAAAATACTTTGTTTAAATTATGAGAAACCCTGCTTGATCGTAACTGAT
AGTTATAAAGTAGATAATTGGAAAATAAAAGTATAAAAATGGATTCCTAACTAAAAAATA
TCAAAAATCTAAAATTAAAACGATACTGTTTAATCATGTCCATTAGTTATCATAGTTAAC
TACGAGCACTTTTAGAATAATTATGAATGTCTGAGTGTTATAAATTTTGAATTTCTAATA
CTTGACATTCATGTTGATTAGATTAAAACAAATAACTATGATAGCTTATGTAAAATAAGA
AGTAATACAAAATCAGTAATTATAATTGAAAATTATGAGAGATTAAATACTATTGAAGAC
TACTGGTTATATCTTGCAATCCTGCATTCAACAATTTTCAAATTTGAAAGATTCAGCAAA
TTATAAAAAAGATATGCAATACTAGATCAAAATTCAGTCTCATATTAAGAATTTTCTTAT
ATTTTATCAGAATTTTTTCAAACAAACAAAAGTAGAGAAAATCATAAAATTGAGAGTCAA
TCTCTTTTTTAAAAATTTAGCATAGAATTAAATCTCAAGTAAAAAAAGTAGGTATAGTTA
ATTTAAAGACAATTCAATGGATGGGAAATATAAGAATTTGCTAATATTGGTTATCATACT
AATGAAGATATTAATACATACTTTTAATATCTAACTAATTTAAAAGAATAACATAAAAAT
ACTCTCTTAAAATATTTAAGTTTATTGAAGAGAAAGACTCTAGTTATAGCAGATGGAGAT
TAAGTATTGTGTAAATTATTCAAAAAGTATAAAAATGTATAATTTATTTCATCAGAATCT
GATCTTAGTATAGTCAGTCTGAAGGAATATGGTTAAATCTTGATTCTAGAAATTGATCAA
AACTATGAGGTAAAAAAAGCATTCATCCAAAGACTTAAGTAAGATGAAATAATTAAAACG
AGAATGATCTTTTTAGAAATTGCAGACACCTTAGACTCTACTTTGATTGATTATTTTATA
TCTTGA


>TTHERM_00530659(gene)
ATGGCAATTCAACCAAAGGCAAAGTTTTATTTAATAGGAAATAACTAATTTTTGTTGTAA
AGCCAATATCCAATAATACAATAAAAACTAGTTAGCTTATTGGTATAATATTACCTTGAA
ATTAACTTTAAACATTTCTTTAGCTCAAACTCATATGCAATTTGCTTGATAATAATAATT
AAAATTTTTCATTTATTATTTTAATTATAAAGTAAAATTTAGGAATCAACATAAAAAATG
AAGAGAGTTTTACATAAAAAATACTGTTAAGCAATGAAGATAGAAAAAAAATATTGAAAA
ATGAAGAAGTATTTGAATTAAAAATTTTTTTATTTTTATTTTTTTCATTAAATCAAATTA
GATTTAAAAGCTGATCAAAATCAAAGACATCCCAAAGTTTTTAAAATAAATTATATCTCT
ACCCAAGTATTAAGTAGACTAGACTCAAATTCAAAAAAAAGTAAAATACTAAAATGAATT
AATTAAATTGAAATAAATTAAACATAAAAGATTAAATAACTAAGTGATGTTAAACCTTCT
AAGTATTTTGTTTAGTTTTTTATTGATTACATAGAAAAGCAAGGTAAGATTCTTTTCCTA
GATGATGAAGTATTTAAATTTACTATTTAAAGAGCTATTATTTTTAAAAATATTTATAAA
ATAGATATTTCCAAAGGTAGAAACTATATCATTTCTAATTAAAATACTTTGTTTAAATTA
TGAGAAACCCTGCTTGATCGTAACTGATAGTTATAAAGTAAACTTTAATCAGCTTAAATA
AAAAATTTACTATTGCTTTTATAAAGGTAGATAATTGGAAAATAAAAGTATAAAAATGGA
TTCCTAACTAAAAAATATCAAAAATCTAAAATTAAAACGATACTGTTTAATCATGTCCAT
TAGTTATCATAGTTAACTACGAGCACTTTTAGAATAATTATGAATGTCTGAGTGTTATAA
ATTTTGAATTTCTAATACTTGACATTCATGTTGATTAGATTAAAACAAATAACTATGATA
GCTTATGTAAAATAAGAAGTAATACAAAATCAGTAATTATAATTGAAAATTATGAGAGAT
TAAATACTATTGAAGACTACTGGTTATATCTTGCAATCCTGCATTCAACAATTTTCAAAT
TTGAAAGATTCAGCAAATTATAAAAAAGATATGCAATACTAGATCAAAATTCAGTCTCAT
ATTAAGAATTTTCTTATATTTTATCAGAATTTTTTCAAACAAACAAAAGTAGAGAAAATC
ATAAAATTGAGAGTCAATCTCTTTTTTAAAAATTTAGCATAGAATTAAATCTCAAGTAAA
AAAAGTAGGTATAGTTAATTTAAAGACAATTCAATGGATGGGAAATATAAGAATTTGCTA
ATATTGGTTATCATACTAATGAAGATATTAATACATACTTTTAATATCTAACTAATTTAA
AAGAATAACATAAAAATACTCTCTTAAAATATTTAAGTTTATTGAAGAGAAAGACTCTAG
TTATAGCAGATGGAGATTAAGTATTGTGTAAATTATTCAAAAAGTATAAAAATGTATAAT
TTATTTCATCAGAATCTGATCTTAGTATAGTCAGTCTGAAGGAATATGGTTAAATCTTGA
TTCTAGAAGTAAATTAATCCATTAAAAAAAAAATGAAAAAACTTATAATTTATATTATTT
TAATAAAAAGATTGATCAAAACTATGAGGTAAAAAAAGCATTCATCCAAAGACTTAAGTA
AGATGAAATAATTAAAACGAGAATGATCTTTTTAGAAATTGCAGACACCTTAGACTCTAC
TTTGATTGATTATTTTATATCTTGA