Identifiers and Description

Gene Model Identifier

TTHERM_00530550

Standard Name

None

Aliases

PreTt04718 | 67.m00233 | 3684.m00103

Description

translation initiation factor eIF-2B subunit epsilon putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00483 ) nucleotidyl transferase
  • ( TIGR00454 ) conserved hypothetical protein TIGR00454
  • ( TIGR02623 ) glucose-1-phosphate cytidylyltransferase
  • ( TIGR01207 ) glucose-1-phosphate thymidylyltransferase
  • ( TIGR01099 ) UTP-glucose-1-phosphate uridylyltransferase
  • ( TIGR01668 ) HAD superfamily (subfamily IIIA) phosphatase,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00530550

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13599.19.997093137033517e-262hypothetical protein (428 aa)
OxytrichaContig6479.0.g311.999618694399617e-70Bacterial transferase hexapept
ide (six repeats)
DictyBaseDDB_G02831635.997672135862771e-69eif2b5 on chromosome: 4 positi
on 349612 to 351949
SGDYDR211W5.000412888119721e-59GCD6 Catalytic epsilon subunit
of the translation initiation
factor eIF2B, the guanine-nuc
leotide exchange factor for eI
F2; activity subsequently regu
lated by phosphorylated eIF2;
first identified as a negative
regulator of GCN4 expression
WormBaseWBGene000084284.999723464643358e-28status:Partially_confirmed U
niProt:Q18994 protein_id:CAA
91063.1
Stentor CoeruleusSteCoe_326521.185064864233981e-27

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00530550(coding)
ATGAAGAAGTAGACCCAAAAGCCTATAGATAAAGAAAAAATAGAAATTAGAGAAAATTTC
TAAGCTGTTCTCCTTGCTGATACATATGTTACTAGATTAGCACCTATCACAAAAGAAATT
CCTAAATGTCTCTTACCTGTAGCAAATGTACCTCTGATTGAGCATACAATTAATTGGCTT
GAAGCAAATAAAATTTATGAATTGTTAGTTGTTTATACATCACACAGCTAAAAAATAGAA
TAATATTTCTCTCAAAGAGATAAAAGTAGCATGAAAATACAGTTAATACATGCTCATGAT
GCAAAAACTGTTGGTGATGCTTTAAGAGAATTGTAATACAAGGGTGTAGTTTATGGAGAT
TTCCTTCTTTGCTATGGAGACATGGTTTCAAATATTAAATTGCAAAGTGCTATTAAGCAT
TTCTTATGGAAGAAGAAGGAGAACTCTCTTAATATTATGACTGCTATTCTTAAAAAGAGC
CACCCATTTGATAGTAATAGAACTTATTAAGATGACGATTTTGCATTTGTCGTTGAAAAA
CAATCAGGGGATATTCTTCAAATTGAAAACATAAACAAGGAAGATTATTTTGAATTAAAT
TTAGAAAGACTTAAAGTCTCTAAGGGTGCTGCACTTGGCTAAAAAATTCATTACAACTAC
TTAGATAATTAAATATACATTTGTTCTTTGGATGTTTTAAAGGCTTTTTAAGAAAACTTT
ACATTCAACTCTTTTAGGGAAGATTTTATGAAAGAGTTGTTAACTGCTGAAATTAATGAA
GAAAAGATTAGTTCATATATAATATCCGACTCGGAGTATGCTTTAAGAGCTAGTGATCCT
AGACTTTACTATAAAATAAATTAATCAGTTATCAAAAGATACACTTATCCCTTTACTGTT
AATAAGATGATGGCTTATTAGAAATAAAATATTTTAAATTAAGACTTTAATATTTTCATG
GGGAAAACTACTAAAATAGCACACAGCACAGTGATTGGAAATAATTCATGTATAGGAGAT
GCTACTTAAATTGGTGATAATACTAACGTTCAAGCTTCTGTGATAGGAAAAAACTGTAAC
ATTGGATCAAACGTTTAGATTCAAAGATGCATTATTCAAGATAATGTCATAATTGAGGAT
GGCACTATAATAAAGGACTCAATCATATGCAATCATGTAGTGATAAAAAAGAATTGCATT
GTTAAAGAAGGATCAATATTGTCATACAATGTAATTACAAAGCAAGATATAACACTTCCA
GAATACACTATGGCCACAACCTTTGAGTACGATAAGGATTTGATAGAAGAAAATTAAGAA
GAAAGTAGTAAACTGTTTGAAAAAGGTGTCATTTACGCTGCATAACTATTCATACAAAAT
GAAGCTATGTTAGGCTATAATCAACATGAAATAATAAAAAATTATGAAGATGTAGATGAC
TTAGTCCATGAAGAAAAAGAAGGATCTGAAGAAGACATTGGTTAAAGAGAAGATGCCATA
TTTTAATAATTAGCAGAAGATATAAGACAAATTATTCAAGAAGCTCTTAATGATCCTCCT
AAGACTGATCACAGCATAGTTGAAATACACAATCTTAAGGTTGCAGAAAATACAGAGGGT
TGGAGATGCATTCAAGTATTTGTTCCTGAAATTCTTAATGGCTTAATAGTAAAATTTAAA
GCGAGTGCCAATCCATAAGAAAGAATAGGTCACATAAAAACACTGCTTGGAAATTGGAAT
AAGCTGTTCAGGAAATTTGTTCATTCTGATGAAGACTCTCTCATTTTCATATCAGAAATA
GAATAATTCTGCATCACTCACAAGGATTTCTACGACTTCCTTCACATCTTCTTATAGCTT
CTCTTTTAAAATGAAATTTTAACTAAAGAATATATATTAAACTGGGTTAATGAAAGAAGA
AACTAAAGTAATGACGACCAAAAACATTTCCTTGATTTAGTAATTTTGTTACTTTTATTT
ATATCTCTCTACCTTTCTTTTACAATGCTAATTGGAATTTATTATCCATAATCTAAATCA
AATTATTTTAATGAGTTACAAATACTAGAAGCCTAAACTGGCATATGGCAATAACTAAAA
GGAGCATTTCATTATTTTAACACAAGTGAATTTTCATATTTTTATTATTTATTAGTGTAA
AGATTTTATCGAATGGTTGGAATCAGATGA


>TTHERM_00530550(protein)
MKKQTQKPIDKEKIEIRENFQAVLLADTYVTRLAPITKEIPKCLLPVANVPLIEHTINWL
EANKIYELLVVYTSHSQKIEQYFSQRDKSSMKIQLIHAHDAKTVGDALRELQYKGVVYGD
FLLCYGDMVSNIKLQSAIKHFLWKKKENSLNIMTAILKKSHPFDSNRTYQDDDFAFVVEK
QSGDILQIENINKEDYFELNLERLKVSKGAALGQKIHYNYLDNQIYICSLDVLKAFQENF
TFNSFREDFMKELLTAEINEEKISSYIISDSEYALRASDPRLYYKINQSVIKRYTYPFTV
NKMMAYQKQNILNQDFNIFMGKTTKIAHSTVIGNNSCIGDATQIGDNTNVQASVIGKNCN
IGSNVQIQRCIIQDNVIIEDGTIIKDSIICNHVVIKKNCIVKEGSILSYNVITKQDITLP
EYTMATTFEYDKDLIEENQEESSKLFEKGVIYAAQLFIQNEAMLGYNQHEIIKNYEDVDD
LVHEEKEGSEEDIGQREDAIFQQLAEDIRQIIQEALNDPPKTDHSIVEIHNLKVAENTEG
WRCIQVFVPEILNGLIVKFKASANPQERIGHIKTLLGNWNKLFRKFVHSDEDSLIFISEI
EQFCITHKDFYDFLHIFLQLLFQNEILTKEYILNWVNERRNQSNDDQKHFLDLVILLLLF
ISLYLSFTMLIGIYYPQSKSNYFNELQILEAQTGIWQQLKGAFHYFNTSEFSYFYYLLVQ
RFYRMVGIR


>TTHERM_00530550(gene)
ATGAAGAAGTAGACCCAAAAGCCTATAGATAAAGAAAAAATAGAAGTACCATATTAAACA
ATAGGATTAATAAAAAATAATGCTATATCTAATAATTTGCATATTTAATTTTACTAATAA
GCAAATTTAAAATATTATTTTGATTCTTCAATGATATCAACATTATTTTTAACAAATAGA
TTAGAGAAAATTTCTAAGCTGTTCTCCTTGCTGATACATATGTTACTAGATTAGCACCTA
TCACAAAAGAAATTCCTAAAGTAAGTTTAAAATTAACTTTAAAAATGCAATGAAAAAAAT
GTTTTATTTGTTTTATTGCGAAATTTAAAAAATAAATCTTTAAAATATGTTTAAAATAGT
AAATTAATAGCTAAAAAGCAATTATATAAATATAATAATTTATAAAACAATTTTACATTA
AGTAAGTACTAACATGCTTTTTTATTATTAATTAGTGTCTCTTACCTGTAGCAAATGTAC
CTCTGATTGAGCATACAATTAATTGGCTTGAAGCAAATAAAATTTATGAATTGTTAGTTG
TTTATACATCACACAGCTAAAAAATAGAATAATATTTCTCTCAAAGAGATAAAAGTAGCA
TGAAAATACAGTTAATACATGCTCATGATGCAAAAACGTAAATAAAAATACCTTTAAATA
TGAAATTATTTTTTATAAAATAATTGTTATTTAAGCTAATTGGAATATATATAGCACAAC
TTAGTATTAAGAAAATAGATTATAATTTTTAAGAAGAATGAGTATTTAATATAAATCAAT
ATTTCTTAGCATTTAAATAGAAATTTAAAAATATATAATAGTGTGCATTAAAGAATAGAT
TATTGAAAGGCTTATATATAAATTGAAAATAATACATTAAATTTTAAAGTAGAAGTAAAT
ATTTAGTTTTTATTTGCTAATTAAAAAAGTGTTGGTGATGCTTTAAGAGAATTGTAATAC
AAGGGTGTAGTTTATGGAGATTTCCTTCTTTGCTATGGAGACATGGTTTCAAATATTAAA
TTGCAAAGTGCTATTAAGCATTTCTTATGGAAGAAGAAGGAGAACTCTCTTAATATTATG
ACTGCTATTCTTAAAAAGAGCCACCCATTTGATAGTAATAGAACTTATTAAGATGACGAT
TTTGCATTTGTCGTTGAAAAACAATCAGGGGATATTCTTCAAATTGAAAACATAAACAAG
GAAGATTATTTTGAATTAAATTTAGAAAGACTTAAAGTCTCTAAGGGTGCTGCACTTGGC
TAAAAAATTCATTACAACTACTTAGATAATTAAATATACATTTGTTCTTTGGATGTTTTA
AAGGCTTTTTAAGAAAACTTTACATTCAACTCTTTTAGGGAAGATTTTATGAAAGAGTTG
TTAACTGCTGAAATTAATGAAGAAAAGATTAGTTCATATATAATATCCGACTCGGAGTAT
GCTTTAAGAGCTAGTGATCCTAGACTTTACTATAAAATAAATTAATCAGTTATCAAAAGG
TAATAAAACCAACAATCTATTAAACATTTGATCCAAGTTTTTATTTTTTCTTTCAAAGTT
AATTTGAAAAATTATTAATTATATTTAATTTGGATTGGAGCTAATGCTCTATGCACATCA
AAAACGATTGATATTAATTTAATTTAGTTTTTTAATTAAATAAATAATTGTGCTACTTAT
TTAAAATAATTATTAATATTACTTAATCATTCATTTAAAATTAAAAAATATTATTGAGTG
CTTTAGTCATTGATAAAAGATATTTTTTTAATGAAATATCAAATAAATTAATTTTATTAA
GAAAAATTATTTGAAATAATTTCTAAAATTAATTCTAATAGATTTTTAACAATAAACAAA
TAGAATTACATAAATACACATAAAACATTTAAAAAAATGTTTCATGATTTTAGCTACTTA
ATAAAATTTCATAATTTGCTAAGAATTTAGATAAATAAATATGTTAAGAACATATACTTT
ATTTTATTTTCTATCATTCTTTTATTTTAGCTCTTTTCCAAATATTTTGATTTGTTTATC
ATACTTTAAAAGTCTTCCACCTTTGATAATAAAATACTTGAATTAGTTTACTTATTGTTC
TATTTTACTAATTTTAACTGTAAGTTTAATTTTGCAAATTTGAGTAAAAAAGAATGATAT
AAACCTCACCTTTTCTTTATAGAAACATTATTTAATATATATATAGAATATCTTACATTA
CTGATATTAAATTTCTCAAAATTGACCTAATATTTATAGAAATAAAACTATATTTACCCG
CTTATTTATTATAAAAAAAGATACACTTATCCCTTTACTGTTAATAAGATGATGGCTTAT
TAGAAATAAAATATTTTAAATTAAGACTTTAATATTTTCATGGGGAAAACTACTAAAATA
GCACACAGCACAGTGATTGGAAATAATTCATGTATAGGAGATGCTACTTAAATTGGTGAT
AATACTAACGTTCAAGCTTCTGTGATAGGAAAAAACTGTAACATTGGATCAAACGTTTAG
ATTCAAAGATGCATTATTCAAGATAATGTCATAATTGAGGATGGCACTATAATAAAGGAC
TCAATCATATGCAATCATGTAGTGATAAAAAAGAATTGCATTGTTAAAGAAGGATCAATA
TTGTCATACAATGTAATTACAAAGCAAGATATAACACTTCCAGAATACACTATGGTAATT
AAAATTTTTTCTTTTTTTAAGCAATACTTATTTGTAAATTTTGCAATTCTGGTGATAAGA
AATTTTGATAAAAATCAAAGTCGAACTCAATTAAAAAATATTATTAATCACTCAATATAA
TCTTTAAGTGAATTACACCATACAATAATTAAGGCATATATATATTTTCCCCCAATCTCA
AAAATATTAAAGTGAATTTATAATCACATTAATTTAAAAGTTAGCATTTATAACAAAAAA
AAAGTTTTCTTTTTGATTACATACATAATCTGTAAGAAGATGGACATATTTTTAAATCTT
TTTGATCCTAGTATTTAAGCATTAAAATTTTAATAATGATGTGCAAAGTATTTAAAAAAC
TTAATTCTTAATAGCTGGTATGTCAAACATTATGTAATTAAACGCTTTAAATTTAAGTGA
TGGAAAATTTTTTGCTTTTTTATTTATGCCTAAATTATCATTGAATGAGTAAGTGTTTTG
TTTTTATAGCTAAAAAAATAAAGAAAATTTATTCTTTAAGCTTAAACCTCAACTGATTGA
TAAATACCCCTAAATTTAATATTTAAGTTATGTGGGCATAAAAGAGTATAATACTAATTA
TTATCTCAGCAGATATTACCTTAACAATTATTTTTATAGAACTTTTTAAAATCTTTCTAG
TTAGTTAATAAGTTAGTGTATATCTTTTTTAATAATTTTTTAAGTTTCCCCATATAATAC
GCATTTTGATTTTGTATTTTATTCATGAATTATAACTAATTAGATTTTAGTTTCGAAATT
GAAATTCAACTATTCTATCTAAATTTCATCACATATTTAAGCATATCTTATTTTTGCTTT
TCTATGTAACAATAGCAAAATAATTCTTAGTTGTTGCTATAAAATTTTAAGTTCTTTAAA
ATAAAAATAAACACTCGTCAAATGAGTTAATTTTCAATAAACCAAAAACACATCAAATAT
TTGTATTTTTTGGAAAACTTTATTTGAGGGACATATTTTCATAATTTGAATGCCTAAACC
TAAATTTTTAATTGAATTAAATTTATTTATATTGTTGAATTTCATAGCTCATATACAATA
AAGTATGTTGAATTGCCTTGAAAAAAAATTTAAATTGATAATAAATAGATTTTCCTCTGG
TAGGATGCTTGAACAAGCAAAAAACAATATTTAACTTATTTTATTTATAATTTTGGAAAA
AAAGATTAAGAAAAGTACTTTTAATAAACTTACATTTAAATTTTATGGAATATATCGTTG
AAAATATTCCCAAAATCTAACTATTCAGGATATTTATACTGATTAATTTTAAATATTTTG
AACAGTAGAAAGAAAATATTAAATAACTAACTAGCAAACGAAATTAAATATGACTTTTTT
CTTTTTTATTAAAAATATTAACTAGTCATAAATAGCAAAAAAATACCGTGAAAAAAAATA
AGATAATAAAAATTTTGGCAAATGAAAAAATACGCTAATTAAAAAAAAAGAGATATGATA
TTCCTATCAAAAATTAATCTAATTTCTCATATTTATCAAAAACGTGATTGAGTTTTCTTA
AATAAAAACTATATTAAATAATAAATAGAAGGTTCAGTTTCTTTAATTACTAGAACTTGT
TTCTATCATATCTATTACAAATCTTTATAATTTAAATTTAAATTAGTCTTTTTTCTTCTT
ATTTAATCTTTTTAATATACTAATAATTTTTATACTCCTCCCATACATACATACCTACCT
CCCTCCATTCTTGAAATTGTTTTTGAGTTTTCAAATAGATACCTTACACTAAAATTAAAA
AGTTATGTTTTTTTACCAAATATTTTAGATAATTAGCGAAATTCTTAATAAAAAAATTTT
ATAAAGTAAATTTTATGGCCTTTGTTTTTATCAACAAAATATTTTTATTTCAAAATTTGC
TTAGAAATATTTTCTTTTTCTATATTAAGTTAGTTAGTTAGTTAAATATACTCTCAAAAT
AAAAACTTATAATTGCCAAACAGCATTTATTTATAATTTAAAAATTTGGTTCCTTAATGA
GCGAAAAGGAGCTAAATTTATAGAAACTGTGGACTAGAATAGTCAAAAGTGTATTATACT
CATAAAGCTGTATATCTTTGGTAATATAATAGTAATATGTAGTAATCTTTTACTAATACT
ATTGCACAATTTTTCCTTATTATGATTTTATTTGAAATCAATCAAATTAAGAGGAAAAAA
TCAATACTAAGAATCTAGCATACCTATCAATGATCAATGATCGGGTAGATTTAAAAATAG
ATACAGTAAAAATAATTTAAGGAAATTTAATTTCAAACAAATCTAATAGACATTGAAACT
CATTACTTATTTTTGATTTTATTTAATTATTTATTAATTAATGGTTAACACATAACCTTA
CCTTCTCATCTTAACATTTTATTTAAAGACTTTATAAATATATTTACAAATATCCAAAAA
TACAATTTTTTAATTGCGAAAATTATATTATTCTTAATTTTACAATTTTCCAGTCTATCC
CCAGAACTATTAATCAGCTAAGTTGCATTAAATTATCAATAATATTTGCTTAATATAGAA
CAAAAAATAACCCTTATCTTTACTTACACTTTAAATTTACTCAAAATTGACTATTTTCAA
GAATTATGAATATATAAATAAATTTTTAATCTAGATAGATTAAAATAGCATCAACTTACT
ATCTTTACCAAATATTAAAAAAATTTAATTGTTAAACAAATACAAGAGTTACTCAGATGA
TTTTTTATTGCAAATAAAATAGATTAATATTATTTTAAATTATAATTTTGCTCTCATTAG
GAATTTTTAAGGCTGATTGTTGTTTTAAATTAAAAAGATTGTAAGTAGTTCTAGATAGAG
TAAAATGAAAAATTATCAATATTTTTACACCTTCTATTTCTAGATAAATATTATTTTAAT
CAAACCAAAGCACAAACTTTTTAGGCTAATCACTTACAATTTTCCATTAAGAACCCATCA
CTTAGAATTATTTATTTTTTGATTACACATAAAAATATTGAATTATACAACTAATTTCAA
TAATCAATTCTAAAAATTATTCAAAACTTATATTCTAAAATTCGACAAAATGTCGCTTTG
CAAAAATTCAACTAACTCATTTTCCTTTTAAATTGAAAGCTTAAACTACTTATAATATCT
TAGTCTACCATTTTTTACATAGCTTAAATTATTTGAATCATTCTTAAATTTCTGTTAAAT
TAATTTTTAATATTAACAAGGCCACAACCTTTGAGTACGATAAGGATTTGATAGAAGAAA
ATTAAGAAGAAAGTAGTAAACTGTTTGAAAAAGGTGTCATTTACGCTGCATAACTATTCA
TACAAAATGAAGCTATGTTAGGCTATAATCAACATGAAATAATAAAAAATTATGAAGATG
TAGATGACTTAGTCCATGAAGAAAAAGAAGGATCTGAAGAAGACATTGGTTAAAGAGAAG
ATGCCATATTTTAATAATTAGCAGAAGATATAAGACAAATTATTCAAGAAGCTCTTAATG
ATCCTCCTAAGACTGATCACAGCATAGTTGAAATACACAATCTTAAGGTAAATTTAAGAT
AGTAACTATTGAAAGTTTATAAATGAAAAAAATATTAGCACACATTTTACAATTTTTGTG
TAACAAAATATGATTAGCATCTAATCAGGAAAAAATTTAATTAATTTATTGATATTTAAT
AAAACAATTGAATAATAACCACATCAACGAATTAAAATTTATTCAAGGTTGCAGAAAATA
CAGAGGGTTGGAGATGCATTCAAGTATTTGTTCCTGAAATTCTTAATGGCTTAATAGTAA
AATTTAAAGCGAGTGCCAATCCATAAGAAAGAATAGGTCACATAAAAACAGTAAAAAAAA
TGATAAAAATTATTTAAATCACTTAAAATTATATATTTCTAATAGATTTTTATTTAATTT
TTTATTTAGTGCAGCTTAATAAACATATTTATAATTTTGAATAAAAAAAGCTGCTTGGAA
ATTGGAATAAGCTGTTCAGGAAATTTGTTCATTCTGATGAAGACTCTCTCATTTTCATAT
CAGAAATAGAAGTAAAATTACATACAATTAATGATTATTAAAATGTCTAATCGTTACATT
TACAAAAATCTTAAACCTTGATTACTTTACTTATTCTCATTATATTATAAAATTATTCAC
ACTAATTAGACATTAATCTTTTTGTTAAAAATTATAAATTTGCTTATTAATTAGCTTATT
TAATATGTTTAACTAAAAAAAAGTAATTCTGCATCACTCACAAGGATTTCTACGACTTCC
TTCACATCTTCTTATAGGTATAAATTGAAAATAGAGGAAATATAACATTTTTGAAAATAT
GGAAATTACAGACTTAAAGAAATTTAATTATGCAAATTTTTATTTAAAGTATTTATTTTG
AATATTTAGTAGTTTAGGTGATTTTTGGTACCCTAAATACATACATATATAAAACACCTA
TAAAAAAATCCAAATTCACTTAAATTTATTTTTGAAGGAACGAAGTTTTGATGATTGTTT
TTTTAGATTCAAATTCCAAAAAATCATTATGGAAAAATTTTAGTAATAAAAAAAATCAAT
ACCTAAGATAAACAAAATATTAATTTTATACTTGCATCTTAACAAGAAAAAAAAGTAAGT
ATTATCTTAACTTACCCTCTATTTTTCCATATCTTTAATAAGGAAACTTAAATGAATATT
TAGCAGTTAAATTCAGTAAATTAAATACTAAGAATTCAATTAACCACCACACATTATTTT
AGGAATGGTATATTAGTTTTTGTTTTATACAAGTCTTGATGCACATTCAGAAAATAGTGT
TTTTAATTACTTTAATAAATTATTAGGGTAGGTTTTATTTTTATTTGAAAGATATTTCTT
TCTTGCTTCATTTAAATAATCCCCAATCTATTATAATTATACTATTTTATGATAGAAAAG
AAAAAAGTTGTTTTGATTAGATTACAATTATCTAAGCATTTTTTTTGTTTACATCATCTA
GCAATTCATCTCTATTTACTTTCAATTAGACATAATTGCAAATTTCAAGAATTCTTAAAT
TTTAACTTTATTTATTTATTTTTTCTTCATTTTTTCTCTGAGAAATGCATGAAATAAACA
TAAGTGAATAAAAATAAAATTTTCAAAAATGTTATATCATTTATATAAAATTATTCAATT
TAAATTTTATTCATTTAACAAATTTATTTTTTAAATTTATAACAGCTTCTCTTTTAAAAT
GAAATTTTAACTAAAGAATATATATTAAACTGGGTTAATGAAAGAAGAAACTAAAGTAAT
GACGACCAAAAACATTTCCTTGATTTAGTAATTTTGTTACTTTTATTTATATCTCTCTAC
CTTTCTTTTACAATGCTAATTGGAATTTATTATCCATAATCTAAATCAAATTATTTTAAT
GAGTTACAAATACTAGAAGCCTAAACTGGCATATGGCAATAACTAAAAGGAGCATTTCAT
TATTTTAACACAAGTGAATTTTCATATTTTTATTATTTATTAGTGTAAAGATTTTATCGA
ATGGTTGGAATCAGATGA