Identifiers and Description

Gene Model Identifier

TTHERM_00530440

Standard Name

None

Aliases

PreTt04707 | 67.m00222 | 3684.m00092

Description

zinc finger C3HC4 type (RING finger) protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00628 ) PHD-finger
  • ( PF02891 ) MIZ/SP-RING zinc finger
  • ( PF02809 ) Ubiquitin interaction motif
  • ( PF00097 ) zinc finger, C3HC4 type (RING
  • ( TIGR01510 ) pantetheine-phosphate adenylyltransferase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00530440

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13609.23.0013161285558437e-171hypothetical protein (375 aa)
OxytrichaContig18994.0.g695.0000961330688895e-23Ring finger domain
WormBaseWBGene000072260.0000000000000700196834671948status:Confirmed UniProt:Q17
573 protein_id:CAA84635.1
DictyBaseDDB_G02800890.0000000000010000211161514907DDB_G0280089 on chromosome: 3
position 2915769 to 2917228
SGDYLR247C0.000000100009565553302IRC20 Putative helicase; local
izes to the mitochondrion and
the nucleus; YLR247C is not an
essential gene; null mutant d
isplays increased levels of sp
ontaneous Rad52p foci

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00530440(coding)
ATGTCAAATCCTAAATAAGTCATAACAATAAAAAGAGGAAGTACTCCTTCTTCAAATTAG
AAACCTAGTCCATAAATAAATATGTCCAGAAAGATAGTGGACGCAAACCCTTCATCCCAA
ATTAAAAAAATCACAACAAACACGAGGACAAATACAATTGATGAATAATTTAAATAAATT
GCTAAACAAGGTAATCCTCATACTGAGAAACCTTTTATTTAACAGGTTCCTACATCAAAC
GGAGCAATTTTTGAGAATTAAATAAACAAAATGCCAATTATGAACTAAATAAACACTCAA
CATACATAGAATTCTCCTTTATTTTTAACTAAGTAACAATCGAACTCAGCCAATTACTAA
CCTTTTGGAGTTTCTGAATATGATAAAATGATGGGTAATTATGGATTTCCTTAAGCTCAG
TATACCAAAAAGTAGGAATTAAGAAAAGAAGACATTGTTAGCACAGATGTGTATAAAGAA
CTATTATCGAAATATGAATCTATTGCTGATAAATATTAAGAACTGAAAAATACATATCAA
GAATTATAGGAGTCTCATAGCGAATAAATAAAAAAGCTCAGATTAGATAATCACAAATTT
CTCTAAGAAAATATTCTACTCAAGAGGAAAAATTAAGAGCTTGTCAAGCAAAACAAATAG
TTGAAAGAATAAATTGTTGTTGCCTAAAATGAGGAGAGAAAAGATAACCATGAATAACTA
TTAGAAATGATGTATGCTATCAGATTACATCAGCAAGAAGAATAAATGCTTTAAATGGCT
ATTCAGTAATCTGCTGAGGAATTTTAAAATGATCCTAATTTTGTTAACGTAGACAATATG
ACATACGAAGAAATGTTAGAACTTGAAGAAAAGAATGGGAAAGTTTCAAGAGGATTACCT
CAAGAGATTATTTAATAAATTCCATCTGTTAACTTCAACTCAAGGCTTAAAATTATTTCA
GAAAAATGTACAATATGCATTAGTGAATTCGAATATGGAGAAAAGTTGAAATAATTACCA
TGCAAGCATATTTACCATCCTGAATGTGTGGACAACTGGTTAAAATAAGAAAAAAAGTGT
CCAGTATGCAAGGGAGAAATAAACTATAACTGA


>TTHERM_00530440(protein)
MSNPKQVITIKRGSTPSSNQKPSPQINMSRKIVDANPSSQIKKITTNTRTNTIDEQFKQI
AKQGNPHTEKPFIQQVPTSNGAIFENQINKMPIMNQINTQHTQNSPLFLTKQQSNSANYQ
PFGVSEYDKMMGNYGFPQAQYTKKQELRKEDIVSTDVYKELLSKYESIADKYQELKNTYQ
ELQESHSEQIKKLRLDNHKFLQENILLKRKNQELVKQNKQLKEQIVVAQNEERKDNHEQL
LEMMYAIRLHQQEEQMLQMAIQQSAEEFQNDPNFVNVDNMTYEEMLELEEKNGKVSRGLP
QEIIQQIPSVNFNSRLKIISEKCTICISEFEYGEKLKQLPCKHIYHPECVDNWLKQEKKC
PVCKGEINYN


>TTHERM_00530440(gene)
ATGTCAAATCCTAAATAAGTCATAACAATAAAAAGAGGAAGTACTCCTTCTTCAAATTAG
AAACCTAGTCCATAAATAAATATGTCCAGAAAGATAGTGGACGCAAACCCTTCATCCCAA
ATTAAAAAAATCACAACAAGTATATTAATTAATATTAAATTTAAACTTTTAACTAGTTGC
TTGACTAAAAAATTTAATGAAGCAACTGCATCTCTTACAGCTCACTAAAAACTTTTATTT
CAAAATAGACACGAGGACAAATACAATTGATGAATAATTTAAATAAATTGCTAAACAAGG
TAATCCTCATACTGAGAAACCTTTTATTTAACAGGTTCCTACATCAAACGGAGCAATTTT
TGAGAATTAAATAAACAAAATGCCAATTATGAACTAAATAAACACTCAACATACATAGAA
TTCTCCTTTATTTTTAACTAAGTAACAATCGAACTCAGCCGTAATTATATTTATTTCATT
TTAAAATTAATTTTAAAAGCCCTTTTCAGATATAAACTTTAAAAAATTAGAATTACTAAC
CTTTTGGAGTTTCTGAATATGATAAAATGATGGGTAATTATGGATTTCCTTAAGCTCAGT
ATACCAAAAAGTAGGAATTAAGAAAAGAAGACATTGTTAGCACAGATGTGTATAAAGAAC
TATTATCGAAATATGAATCTATTGCTGATAAATATTAAGAACTGAAAAATGTAAACCACT
TTTTTTATTTTTTTAAACTTTTTAATAACATTTTTAGCTATAACAATAAAAAACAAAGAT
TTAAATAGAGAATTAGATAAATTGCTTTTATTTATAGATATTCATGCTAGAAATTAATTT
TATTTTTCATATTAATTTACATATTGATTAACACTTTTATAATTATAAAATGATTTCAGA
CATATCAAGAATTATAGGAGTCTCATAGCGAATAAATAAAAAAGCTCAGATTAGATAATC
ACAAATTTCTCTAAGAAAATATTCTACTCAAGAGGAAAAATTAAGAGCTTGTCAAGCAAA
ACAAATAGTTGAAAGAATAAATTGTTGTTGCCTAAAATGAGGAGAGAAAAGGTTAGTTAA
AAAAAATATTTTTATTAAATATTTAATAGTTATTTAATTACTTAATAGATAACCATGAAT
AACTATTAGAAATGATGTATGCTATCAGATTACATCAGCAAGAAGAATAAATGCTTTAAA
TGGCTATTCAGTAATCTGCTGAGGAATTTTAAAATGATCCTAATTTTGTTAACGTAGACA
ATATGACATACGAAGTAATTGAATATTTTAAAATCATAAATGACTATATAATATGTTTAT
TTTATTTAGGAAATGTTAGAACTTGAAGAAAAGAATGGGAAAGTTTCAAGAGGATTACCT
CAAGAGATTATTTAATAAATTCCATCTGTTAACTTCAACTCAAGGCTTAAAATTATTTCA
GAAAAATGTACAATATGCATTAGTGAATTCGAATATGGAGAAAAGTTGAAATAATTACCA
TGCAAGCATATTTACCATCCTGAATGTGTGGACAACTGGTTAAAATAAGAAAAAAAGTGT
CCAGTATGCAAGGGAGAAATAAACTATAACTGA