Identifiers and Description

Gene Model Identifier

TTHERM_00530039

Standard Name

PARS2 (Partner of SPO11 2)

Aliases

None

Description

transmembrane protein putative Required for the induction of meiotic DNA double-strand breaks

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.4%

TetraMine Data

TTHERM_00530039

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

No Data fetched for Homologs

General Information

Paragraph NoGene NameParagraph Text
150PARS2Coding sequence is mispredicted. For transcript sequence refer to TetraFGD (http://tfgd.ihb.ac.cn/)

Associated Literature

  1. Ref:SUPR000520

Sequences

>TTHERM_00530039(coding)
ATGCAGAAATTGAGTTTATTAGATAATTTTAAAGCCATCTAGATATTATTCTAGATCATT
TAAATCTCGATTATTATCTTCTTCTGTATTTTTTACTAAATTGATAATAAATAGAAAATT
GTAATAATTCTTTATTCCTCTTTTTTTAGGTATGTTTTTCTAAACATGCAAATTAGTTTT
AATCTCTCTTTTATTACTATATTAAAATTTATCGTTTATTTAACTTAGTAAAGCATTCAT
TACTTTCTTTTGAATTTCTTATAATTCAACTTTAATTGTCATTTACCCATTTTCGTAGAA
ATAAAAATATACGCATTACTCAATATCTGA


>TTHERM_00530039(protein)
MQKLSLLDNFKAIQILFQIIQISIIIFFCIFYQIDNKQKIVIILYSSFFRYVFLNMQISF
NLSFITILKFIVYLTQQSIHYFLLNFLQFNFNCHLPIFVEIKIYALLNI


>TTHERM_00530039(gene)
ATGCAGAAATTGAGTTTATTAGATAATTTTAAAGCCATCTAGATATTATTCTAGATCATT
TAAATCTCGATTATTATCTTCTTCTGTATTTTTTACTAAATTGATAATAAATAGAAAATT
GTAATAATTCTTTATTCCTCTTTTTTTAGGTATGTTTTTCTAAACATGCAAATTAGTTTT
AATCTCTCTTTTATTACTATATTAAAATTTATCGTTTATTTAACTTAGTAAAGCATTCAT
TACTTTCTTTTGAATTTCTTATAATTCAACTTTAATTGTCATTTACCCATTTTCGTAGAA
ATAAAAATATACGCATTACTCAATATCTGA