Identifiers and Description

Gene Model Identifier

TTHERM_00529580

Standard Name

None

Aliases

PreTt04627 | 67.m00142 | 3684.m00012

Description

kelch motif protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.8%

TetraMine Data

TTHERM_00529580

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13691.19.997093137033517e-262kelch domain-containing protei
n family protein (556 aa)
DictyBaseDDB_G02707500.0000009995106777214876DDB_G0270750 on chromosome: 1
position 4356679 to 4358223
OxytrichaContig3300.0.g410.0000020007268868677913Kelch motif
WormBaseWBGene000082670.000009999254677478949status:Partially_confirmed U
niProt:O17700 protein_id:CAB
03989.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00529580(coding)
ATGCCAGTTTGTACAGGAACAAATACTTGTAAATAACAAGGAAGATAGATTAGATGGATT
TGCTTACACCCAATATGTAGCAACTTCAAAGAATTGTGTGACGAATGCCACAAAAATCAC
TTATAATTCCATTAGAAGTATAAAGTAGAAAATGAACCAGAACCAAACAATACTATTGTT
ACATTTGATGATCAAAAAAATACTGTTGAAAAGATTCTTTTGAGAGTTAGAGAAGATCTT
AAATTTTTTAAAGATAGAGCTTCTTCAGAGATTTAAAATATGGAAAATACAGAATTACCA
ATTAATAATATTGTAAAAGAGTTACAAGAAATTAGGAGAATGATTAATTAAGAATTTGAT
CATTTTATTGAACAGCTTGTAGATGATTACGAAAAACCTATAAAAGATAAAATAAAAGAT
GTCTATAACGAAATATAAACAAAAATAACTGAAACAGATGATTTTATTTCTAAATTAAAC
TCAGTGGATTAGCTGGAAACGATTAAACTTACTAGTATTATTGATATACCATATTAGACA
TCGTTTTAAAAAGCTCGCTTGGAGTAACTTTTTGATGAGCGTACAACAAAAAAATTTGAA
GGAGTAATAGATGATGATGTGGTCTTGCGCTTTTTAGGCTCATTTTAGCAGGAACTAAAA
AATTTGATTTATATTCCATCAGAAAAAAATGAATTAAAAAAGAAGCTTATGGTGTAAAAA
AAGCAGAGAGCCCCTCTAAACTCTAAAAAGAACTGGCTCTTCTATTTTGAACCTAATACT
AAAAACTTTTATTATGTAGATACTTCTAAAACAAATCCATAGATTACAAAGATTGTATTA
GATAATATATCTTTTAATATTTATTATGGTAACAGATCTATACTGGCTAGTGATGATAAT
ATTTATTTAATTGGAGGCTATGATCAAAAAAATATTAATTCTGAAAACGAGGAGTAATAT
AAATCAGTATATTTGCTTGATCTAGATTAAAAAACTTTAAAAAAGGTTAGTAGTTTGCTT
ACTCTTAGACACAGTTTTGGTTTATGTTGTTTTTAAAATTATCTTTATATCATTGGAGGC
TATAATTATTAAGAAGGAAGTTTGGCTAAATGTGAAAAAATATCACTCTAAAAGGTTAAT
TAGCACAATGCTATACCTATAAGTAATTTGCTTTAGAAGACATCTCATGCTTCAGTATGC
TCTTGGTAAGATAAAATAATTGTCAAGTTTGGTGGAATATAATTTGACTCTAACTCAACA
GATCAACGAAACTAATCAAAAACACCCAGGATTTTAGCTGAATCGTTGTTTGAATTCTAT
TTCCCTGATTTGGATTAATGGATATAAATGCCTCAATTGAATTAATGTGTAAGTCAATCC
TTTTTATCAACTATTATAGAAGTTAATGATTAGATATATATTTTTGGAGGATTAGATGAA
AATTTATAACTTCTAAAGAAATGCACCAAAATACAGTAATACAATCTGATGAAACTTGAT
ATCGAAGTAATTAATCAACCTGATTTAGCTAATAAATCCTATTCAATCTGTTAGCCAATT
TTTAGAGAGTTAGATAATTAAGCTTTTAAGGTATTTTACCTAAGTTACGAAACAAACGAT
TACAAAAACTAACGCGTTTAACCTGTATTACGTTCTTTAATAGTATGA


>TTHERM_00529580(protein)
MPVCTGTNTCKQQGRQIRWICLHPICSNFKELCDECHKNHLQFHQKYKVENEPEPNNTIV
TFDDQKNTVEKILLRVREDLKFFKDRASSEIQNMENTELPINNIVKELQEIRRMINQEFD
HFIEQLVDDYEKPIKDKIKDVYNEIQTKITETDDFISKLNSVDQLETIKLTSIIDIPYQT
SFQKARLEQLFDERTTKKFEGVIDDDVVLRFLGSFQQELKNLIYIPSEKNELKKKLMVQK
KQRAPLNSKKNWLFYFEPNTKNFYYVDTSKTNPQITKIVLDNISFNIYYGNRSILASDDN
IYLIGGYDQKNINSENEEQYKSVYLLDLDQKTLKKVSSLLTLRHSFGLCCFQNYLYIIGG
YNYQEGSLAKCEKISLQKVNQHNAIPISNLLQKTSHASVCSWQDKIIVKFGGIQFDSNST
DQRNQSKTPRILAESLFEFYFPDLDQWIQMPQLNQCVSQSFLSTIIEVNDQIYIFGGLDE
NLQLLKKCTKIQQYNLMKLDIEVINQPDLANKSYSICQPIFRELDNQAFKVFYLSYETND
YKNQRVQPVLRSLIV


>TTHERM_00529580(gene)
ATGCCAGTTTGTACAGGAACAAATACTTGTAAATAACAAGGAAGATAGATTAGATGGATT
TGCTTACACCCAATATGTAGCAACTTCAAAGAATTGTGTGACGAATGCCACAAAAATCAC
TTATAATTCCATTAGAAGTATAAAGTAGAAAATGAACCAGAACCAAACAATACTATTGTT
ACATTTGATGATCAAAAAAATACTGTTGAAAAGATTCTTTTGAGAGTTAGAGAAGATCTT
AAATTTTTTAAAGATAGAGCTTCTTCAGAGATTTAAAATATGGAAAATACAGAATTACCA
ATTAATAATATTGTAAAAGAGTTACAAGAAATTAGGAGAATGATTAATTAAGAATTTGAT
CATTTTATTGAACAGCTTGTAGATGATTACGAAAAACCTATAAAAGATAAAATAAAAGAT
GTCTATAACGAAATATAAACAAAAATAACTGAAACAGATGATTTTATTTCTAAATTAAAC
TCAGTGGATTAGCTGGAAACGATTAAACTTACTAGTATTATTGATATACCATATTAGACA
TCGTTTTAAAAAGCTCGCTTGGAGTAACTTTTTGATGAGCGTACAACAAAAAAGTAACAT
TAACATTAATTATCATTTAAATAAATTTAGCAAAAATTAAATTTCCATTAAAAAATTTTG
AATATTAGACCAAAGTTACTTTTATATTATGTTTCTAAAAATTCATCAATATACAAAAAG
ATTTGAAGGAGTAATAGATGATGATGTGGTCTTGCGCTTTTTAGGCTCATTTTAGCAGGA
ACTAAAAAATTTGATTTATATTCCATCAGAAAAAAATGAATTAAAAAAGAAGCTTATGGT
GTAAAAAAAGCAGAGAGCCCCTCTAAACTCTAAAAAGAACTGGCTCTTCTATTTTGAACC
TAATACTAAAAACTTTTATTATGTAGATACTTCTAAAACAAATCCATAGATTACAAAGAT
TGTATTAGATAATATATCTTTTAATATTTATTATGGTAACAGATCTATACTGGCTAGTGA
TGATAATATTTATTTAATTGGAGGCTATGATCAAAAAAATATTAATTCTGAAAACGAGGA
GTAATATAAATCAGTATATTTGCTTGATCTAGATTAAAAAACTTTAAAAAAGGTTAGTAG
TTTGCTTACTCTTAGACACAGTTTTGGTTTATGTTGTTTTTAAAATTATCTTTATATCAT
TGGAGGCTATAATTATTAAGAAGGAAGTTTGGCTAAATGTGAAAAAATATCACTCTAAAA
GGTTAATTAGCACAATGCTATACCTATAAGTAATTTGCTTTAGAAGACATCTCATGCTTC
AGTATGCTCTTGGTAAGATAAAATAATTGTCAAGTTTGGTGGAATATAATTTGACTCTAA
CTCAACAGATCAAGTAAATTAAATTATATTATAAAGAAAAATTATTAAGTTTATTATTTT
ATTAATTGAAAAAGCGAAACTAATCAAAAACACCCAGGATTTTAGCTGAATCGTTGTTTG
AATTCTATTTCCCTGATTTGGATTAATGGATATAAATGCCTCAATTGAATTAATGTGTAA
GTCAATCCTTTTTATCAACTATTATAGAAGTTAATGATTAGATATATATTTTTGGAGGAT
TAGATGAAAATTTATAACTTCTAAAGAAATGCACCAAAATACAGTAATACAATCTGATGA
AACTTGATATCGAAGTAATTAATCAACCTGATTTAGCTAATAAATCCTATTCAATCTGTT
AGCCAATTTTTAGAGAGTTAGATAATTAAGCTTTTAAGGTATTTTACCTAAGTTACGAAA
CAAACGATTACAAAAACTAACGCGTTTAACCTGTATTACGTTCTTTAATAGTATGA