Identifiers and Description

Gene Model Identifier

TTHERM_00529510

Standard Name

None

Aliases

PreTt04620 | 67.m00135 | 3684.m00005

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF05377 ) Flagella accessory protein C (FlaC)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_00529510

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13702.13.9985196551577655e-99hypothetical protein (148 aa)
OxytrichaContig11920.0.g232.0004286606204839e-16IncA protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00529510(coding)
ATGGCTGATTACGATAATTAATATGATCATTATGATATGACTGAAGTAATGAGGCAGTAA
AATTAAGCTGAGTTAGAGCTTTCAGCAAAATTACCTATTAAAAATCATCTAGAGAGACTT
GATATGACTTTAGAAAATCTGCTTAAAGATTTAGAAGATAGTAAAAAAGACCTCTAGTCG
TTAAGAAATGATGTAGTAAGTTTAGGACATTTAAATAATGATTAATGCTCTGAATTAAGT
AGATTTGTTATGGATGAAACTCTTAGATTAGCTAAAGATTTTAGAAAATTAACAAATATC
GAACAAGATGAGTGCACCTATTTAAAGTAATAAGTAAATTAGCTTACTTAGGATAGAATC
CGCCTTCAATAGAACACTTTAGTGTTAGAAAATAGAGTAAATGAAACTGAAAAAGATGTA
GGCTTTAGACATATGTACGATTGA


>TTHERM_00529510(protein)
MADYDNQYDHYDMTEVMRQQNQAELELSAKLPIKNHLERLDMTLENLLKDLEDSKKDLQS
LRNDVVSLGHLNNDQCSELSRFVMDETLRLAKDFRKLTNIEQDECTYLKQQVNQLTQDRI
RLQQNTLVLENRVNETEKDVGFRHMYD


>TTHERM_00529510(gene)
ATGGCTGATTACGATAATTAATATGATCATTATGATATGACTGAAGTAATGAGGCAGTAA
AATTAAGCTGAGTTAGAGCTTTCAGCAAAATTACCTATTAAAAATCATCTAGAGAGACTT
GATGTAACTAAATTAATCATTCATTATTTCACATATATTTAACATTCTCCATAAAAGCAA
AGTCAACTTTCCCAATAGAAAAAGAAAAAAGTTGAGTTAAGTTATAATTTGTTTCATTTA
AATTGTAAAGTTGTTGAAATTCAATAAATTTTAAGAAATAATTTCATAATGATTGAGAGA
TAAAAATTTTACATTTTAAAGTTGAACATAATTAATTGTAATTTATTATTTGTTTTAGAT
GACTTTAGAAAATCTGCTTAAAGATTTAGAAGATAGTAAAAAAGACCTCTAGTCGTTAAG
AAATGATGTAGTAAGTTTAGGACATTTAAATAATGATTAATGCTCTGAATTAAGTAGATT
TGTTATGGATGAAACTCTTAGATTAGCTAAAGATTTTAGAAAATTAACAAATATCGAACA
AGATGAGTGCACCTATTTAAAGTAATAAGTAAATTAGCTTACTTAGGATAGAATCCGCCT
TCAATAGAACACTTTAGTGTTAGAAAATAGAGTAAATGAAACTGAAAAAGATGTAGGCTT
TAGACATATGTACGATTGA