Identifiers and Description

Gene Model Identifier

TTHERM_00526590

Standard Name

DJR1 (DJ-1 Related )

Aliases

PreTt06397 | 66.m00196 | 3722.m00054

Description

DJ-1 family protein; one of two adjacent homologs of this protein family, with TTHERM_00526580

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.2%

TetraMine Data

TTHERM_00526590

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13404.19.002943066426541e-124DJ-1 family protein (192 aa)
OxytrichaContig5064.0.g758.003613776907505e-34DJ-1/PfpI family
WormBaseWBGene000167894.9988726541653934e-26locus:djr-1.2 status:Partial
ly_confirmed UniProt:O16228
protein_id:CCD67692.1
DictyBaseDDB_G02864430.000000009996807949091551DDB_G0286443 on chromosome: 4
position 4513273 to 4513947

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00526590(coding)
ATGGAAGATCAAAAAAGAATTTTAGTTCCCTTAGCTCCAAGCTTTGAAGAAATAGAAGCT
ATTACTGTAATTGATTTATTTCGTCGTATAGGAGCAGATGTTACAGTTGCATCAATTTTA
AACAAAAGTGAAGGATTAGTAGTGAAAGGCGCTAATGGAGTGCAAGTTTTATGCGATAAA
CATTTAGATGAAGTAGTTAATTAAGATTTTGATATGATTGCATGTCCAGGAGGTATGCCA
GGGGCATAACATTTAAGTGATTGCTAAATTCTCATTGAAAGATTAAAGAAATAGAGAGAA
TAAGATAAATATTATGCTGCAATTTGTGCCGCTCCATATGTCATATTTGAGAAGCACGGA
TTTTTGAATAGTTAAATTGCTGGAACTTGCCATCCTGGATTTGCTGATAAACTTTCCAAT
AAATCTAAAATTGACTAAGATGTTGTTGTTACAGGTAAATGCATAACTTCTAAAAGTGCA
GGAACTGCTATGGATTTTGGACTTTAGCTTCTTAGATTACTCTATTCTGAATAAAAAGTT
CTTGAGGTATTAAAAAGATTAGCATATAGAAAATGA


>TTHERM_00526590(protein)
MEDQKRILVPLAPSFEEIEAITVIDLFRRIGADVTVASILNKSEGLVVKGANGVQVLCDK
HLDEVVNQDFDMIACPGGMPGAQHLSDCQILIERLKKQREQDKYYAAICAAPYVIFEKHG
FLNSQIAGTCHPGFADKLSNKSKIDQDVVVTGKCITSKSAGTAMDFGLQLLRLLYSEQKV
LEVLKRLAYRK


>TTHERM_00526590(gene)
ATGGAAGATCAAAAAAGAATTTTAGTTCCCTTAGCTCCAAGCTTTGAAGAAATAGAAGCT
ATTACTGTAATTGATTTATTTCGTCGTATAGGAGCAGATGTTACAGTTGCATCAATTTTA
AACAAAAGTGAAGGATTAGTAGTGAAAGGCGCTAATGGAGTGCAAGTTTTATGCGATAAA
CATTTAGATGAAGTAGTTAATTAAGATTTTGATATGATTGCATGTCCAGGAGGTATGCCA
GGGGCATAACATTTAAGTGATTGCTAAATTCTCATTGAAAGATTAAAGAAATAGAGAGAA
TAAGATAAATATTATGCTGCAATTTGTGCCGCTCCATATGTCATATTTGAGAAGCACGGA
TTTTTGAATAGTTAAATTGCTGGAACTTGCCATCCTGGATTTGCTGATAAACTTTCCAAT
AAATCTAAAATTGACTAAGATGTTGTTGTTACAGGTAAATGCATAACTTCTAAAAGTGCA
GGAACTGCTATGGATTTTGGACTTTAGCTTCTTAGATTACTCTATTCTGAATAAAAAGTT
CTTGAGGTATTAAAAAGATTAGCATATAGAAAATGA